GGRNA Home | Help | Advanced search

2019-03-25 14:33:00, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_205845               3521 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens aldo-keto reductase family 1, member C2 (AKR1C2),
            transcript variant 2, mRNA.
ACCESSION   NM_205845 XM_001128335 XM_001128348 XM_001128387 XM_001128420
VERSION     NM_205845.2  GI:359751396
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3521)
  AUTHORS   Kuang,P., Zhou,C., Li,X., Ren,S., Li,B., Wang,Y., Li,J., Tang,L.,
            Zhang,J. and Zhao,Y.
  TITLE     Proteomics-based identification of secreted protein dihydrodiol
            dehydrogenase 2 as a potential biomarker for predicting cisplatin
            efficacy in advanced NSCLC patients
  JOURNAL   Lung Cancer 77 (2), 427-432 (2012)
   PUBMED   22534668
  REMARK    GeneRIF: DDH2 expression might be a potential predictor and monitor
            of cisplatin efficacy in advanced NSCLC patients.
REFERENCE   2  (bases 1 to 3521)
  AUTHORS   Veilleux,A., Cote,J.A., Blouin,K., Nadeau,M., Pelletier,M.,
            Marceau,P., Laberge,P.Y., Luu-The,V. and Tchernof,A.
  TITLE     Glucocorticoid-induced androgen inactivation by aldo-keto reductase
            1C2 promotes adipogenesis in human preadipocytes
  JOURNAL   Am. J. Physiol. Endocrinol. Metab. 302 (8), E941-E949 (2012)
   PUBMED   22275760
  REMARK    GeneRIF: Data suggest that modulation of AKR1C2 by glucocorticoids
            (dexamethasone in this study) locally modifies exposure of adipose
            cells to endogenous androgens; thus, AKR1C2 activation/inactivation
            may be involved in regional fat deposition.
REFERENCE   3  (bases 1 to 3521)
  AUTHORS   Roberson,A.E., Hyatt,K., Kenkel,C., Hanson,K. and Myers,D.A.
  TITLE     Interleukin 1beta regulates progesterone metabolism in human
            cervical fibroblasts
  JOURNAL   Reprod Sci 19 (3), 271-281 (2012)
   PUBMED   22064385
  REMARK    GeneRIF: Data suggest that interleukin-1beta facilitates
            progesterone metabolism in cervical fibroblasts by regulating
            expression of AKR1C1 and AKR1C2.
            Erratum:[Reprod Sci. 2012 Jun;19(6):666]
REFERENCE   4  (bases 1 to 3521)
  AUTHORS   Jin,Y., Mesaros,A.C., Blair,I.A. and Penning,T.M.
  TITLE     Stereospecific reduction of 5beta-reduced steroids by human
            ketosteroid reductases of the AKR (aldo-keto reductase)
            superfamily: role of AKR1C1-AKR1C4 in the metabolism of
            testosterone and progesterone via the 5beta-reductase pathway
  JOURNAL   Biochem. J. 437 (1), 53-61 (2011)
   PUBMED   21521174
  REMARK    GeneRIF: role of AKR1C2 in the metabolism of testosterone and
            progesterone via the 5beta-reductase pathway.
REFERENCE   5  (bases 1 to 3521)
  AUTHORS   Basehore,H.K. and Ropson,I.J.
  TITLE     Residual interactions in unfolded bile acid-binding protein by 19F
            NMR
  JOURNAL   Protein Sci. 20 (2), 327-335 (2011)
   PUBMED   21280124
  REMARK    GeneRIF: The folding initiation mechanism of human bile
            acid-binding protein (BABP) has been examined by (19) F NMR.
REFERENCE   6  (bases 1 to 3521)
  AUTHORS   Khanna,M., Qin,K.N., Klisak,I., Belkin,S., Sparkes,R.S. and
            Cheng,K.C.
  TITLE     Localization of multiple human dihydrodiol dehydrogenase (DDH1 and
            DDH2) and chlordecone reductase (CHDR) genes in chromosome 10 by
            the polymerase chain reaction and fluorescence in situ
            hybridization
  JOURNAL   Genomics 25 (2), 588-590 (1995)
   PUBMED   7789999
REFERENCE   7  (bases 1 to 3521)
  AUTHORS   Qin,K.N., Khanna,M. and Cheng,K.C.
  TITLE     Structure of a gene coding for human dihydrodiol dehydrogenase/bile
            acid-binding protein
  JOURNAL   Gene 149 (2), 357-361 (1994)
   PUBMED   7959017
REFERENCE   8  (bases 1 to 3521)
  AUTHORS   Ciaccio,P.J. and Tew,K.D.
  TITLE     cDNA and deduced amino acid sequences of a human colon dihydrodiol
            dehydrogenase
  JOURNAL   Biochim. Biophys. Acta 1186 (1-2), 129-132 (1994)
   PUBMED   8011662
REFERENCE   9  (bases 1 to 3521)
  AUTHORS   Qin,K.N., New,M.I. and Cheng,K.C.
  TITLE     Molecular cloning of multiple cDNAs encoding human enzymes
            structurally related to 3 alpha-hydroxysteroid dehydrogenase
  JOURNAL   J. Steroid Biochem. Mol. Biol. 46 (6), 673-679 (1993)
   PUBMED   8274401
REFERENCE   10 (bases 1 to 3521)
  AUTHORS   Winters,C.J., Molowa,D.T. and Guzelian,P.S.
  TITLE     Isolation and characterization of cloned cDNAs encoding human liver
            chlordecone reductase
  JOURNAL   Biochemistry 29 (4), 1080-1087 (1990)
   PUBMED   2187532
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DA451165.1, BC063574.1,
            BC007024.1, AL713867.6 and CA450425.1.
            On Dec 9, 2011 this sequence version replaced gi:45446744.
            
            Summary: This gene encodes a member of the aldo/keto reductase
            superfamily, which consists of more than 40 known enzymes and
            proteins. These enzymes catalyze the conversion of aldehydes and
            ketones to their corresponding alcohols using NADH and/or NADPH as
            cofactors. The enzymes display overlapping but distinct substrate
            specificity. This enzyme binds bile acid with high affinity, and
            shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This
            gene shares high sequence identity with three other gene members
            and is clustered with those three genes at chromosome 10p15-p14.
            Three transcript variants encoding two different isoforms have been
            found for this gene. [provided by RefSeq, Dec 2011].
            
            Transcript Variant: This variant (2) differs in the 5' UTR compared
            to variant 1. Variants 1 and 2 encode the same isoform (1).
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC063574.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           ERS025081, ERS025082 [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-33                DA451165.1         1-33
            34-291              BC063574.1         1-258
            292-1508            BC007024.1         1-1217
            1509-3325           AL713867.6         19622-21438         c
            3326-3521           CA450425.1         1-196               c
FEATURES             Location/Qualifiers
     source          1..3521
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="10"
                     /map="10p15-p14"
     gene            1..3521
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /note="aldo-keto reductase family 1, member C2"
                     /db_xref="GeneID:1646"
                     /db_xref="HGNC:385"
                     /db_xref="HPRD:11857"
                     /db_xref="MIM:600450"
     exon            1..134
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /inference="alignment:Splign:1.39.8"
     exon            135..397
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    272..274
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /note="upstream in-frame stop codon"
     CDS             314..1285
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /EC_number="1.1.1.213"
                     /EC_number="1.3.1.20"
                     /note="isoform 1 is encoded by transcript variant 2; type
                     II dihydrodiol dehydrogenase;
                     trans-1,2-dihydrobenzene-1,2-diol dehydrogenase;
                     pseudo-chlordecone reductase; dihydrodiol dehydrogenase 2;
                     bile acid binding protein; 3-alpha hydroxysteroid
                     dehydrogenase, type III; DD-2; DD/BABP; 3-alpha-HSD3;
                     chlordecone reductase homolog HAKRD"
                     /codon_start=1
                     /product="aldo-keto reductase family 1 member C2 isoform
                     1"
                     /protein_id="NP_995317.1"
                     /db_xref="GI:45446745"
                     /db_xref="CCDS:CCDS7062.1"
                     /db_xref="GeneID:1646"
                     /db_xref="HGNC:385"
                     /db_xref="HPRD:11857"
                     /db_xref="MIM:600450"
                     /translation="
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
"
     misc_feature    344..1210
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cd06660"
                     /db_xref="CDD:119408"
     misc_feature    368..1216
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /note="Aldo/keto reductase family; Region: Aldo_ket_red;
                     pfam00248"
                     /db_xref="CDD:201112"
     misc_feature    order(377..385,461..463,476..478,563..565,662..667,
                     809..814,881..883,959..976,1070..1072,1115..1126,
                     1139..1141,1148..1153)
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /note="active site"
                     /db_xref="CDD:119408"
     misc_feature    order(461..463,476..478,563..565,662..664)
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /note="catalytic tetrad [active]"
                     /db_xref="CDD:119408"
     misc_feature    563..565
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Lowers pKa of active site Tyr (By similarity);
                     propagated from UniProtKB/Swiss-Prot (P52895.3); other
                     site"
     exon            398..565
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /inference="alignment:Splign:1.39.8"
     variation       416
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:8625"
     variation       425
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3207898"
     variation       426
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3207901"
     variation       439
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:8493"
     variation       445
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3207903"
     variation       448
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:3207904"
     variation       450
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2854482"
     variation       453
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3207905"
     variation       469
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:8314"
     exon            566..682
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /inference="alignment:Splign:1.39.8"
     variation       640
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:13945"
     variation       645
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2854486"
     exon            683..760
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /inference="alignment:Splign:1.39.8"
     exon            761..883
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /inference="alignment:Splign:1.39.8"
     variation       848
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2518042"
     variation       866
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2518043"
     exon            884..993
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /inference="alignment:Splign:1.39.8"
     exon            994..1159
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /inference="alignment:Splign:1.39.8"
     exon            1160..1242
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /inference="alignment:Splign:1.39.8"
     exon            1243..3506
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /inference="alignment:Splign:1.39.8"
     STS             1375..1492
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /standard_name="RH11162"
                     /db_xref="UniSTS:89050"
     variation       1402
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1138738"
     variation       1405
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1138741"
     variation       1411
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1138743"
     variation       1422
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1138745"
     variation       1436
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1138758"
     variation       1441
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1138759"
     polyA_signal    1476..1481
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
     polyA_site      1495
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
     variation       2113
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:4523595"
     variation       2188
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:4336933"
     variation       2940
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4584482"
     variation       2947
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4526684"
     polyA_site      3506
                     /gene="AKR1C2"
                     /gene_synonym="AKR1C-pseudo; BABP; DD; DD2; DDH2; HAKRD;
                     HBAB; MCDR2; SRXY8"
ORIGIN      
tcataatagaattctcatgagatctggttgtttgaaagtgtgtagcacctccaccttctctctctctctccctctccctctcctgccagccaagtgaagacatgcttacttccccttcaccttccttcatgatggtaagaaacggttgaactggatgcaatttttatcacagcttgtgtaagactgcctctgtccctcctctcacatgccattggttaaccagcagacagtgtgctcaggggcgttgccagctcattgctcttatagcctgtgagggaggaagaaacatttgctaaccaggccagtgacagaaatggattcgaaataccagtgtgtgaagctgaatgatggtcacttcatgcctgtcctgggatttggcacctatgcgcctgcagaggttcctaaaagtaaagctctagaggccgtcaaattggcaatagaagccgggttccaccatattgattctgcacatgtttacaataatgaggagcaggttggactggccatccgaagcaagattgcagatggcagtgtgaagagagaagacatattctacacttcaaagctttggagcaattcccatcgaccagagttggtccgaccagccttggaaaggtcactgaaaaatcttcaattggactatgttgacctctatcttattcattttccagtgtctgtaaagccaggtgaggaagtgatcccaaaagatgaaaatggaaaaatactatttgacacagtggatctctgtgccacatgggaggccatggagaagtgtaaagatgcaggattggccaagtccatcggggtgtccaacttcaaccacaggctgctggagatgatcctcaacaagccagggctcaagtacaagcctgtctgcaaccaggtggaatgtcatccttacttcaaccagagaaaactgctggatttctgcaagtcaaaagacattgttctggttgcctatagtgctctgggatcccatcgagaagaaccatgggtggacccgaactccccggtgctcttggaggacccagtcctttgtgccttggcaaaaaagcacaagcgaaccccagccctgattgccctgcgctaccagctgcagcgtggggttgtggtcctggccaagagctacaatgagcagcgcatcagacagaacgtgcaggtgtttgaattccagttgacttcagaggagatgaaagccatagatggcctaaacagaaatgtgcgatatttgacccttgatatttttgctggcccccctaattatccattttctgatgaatattaacatggagggcattgcatgaggtctgccagaaggccctgcgtgtggatggtgacacagaggatggctctatgctggtgactggacacatcgcctctggttaaatctctcctgcttggcgacttcagtaagctacagctaagcccatcggccggaaaagaaagacaataattttgtttttcattttgaaaaaattaaatgctctctcctaaagattcttcacctactttggtctccataacttctatgttttctctccttctgacacactagtgcccccaaattgtgatttgcctatacgtttagggccggggttggaagatgttaacaaccatttaagattcatttctgcagtgggagtgggtggagtttcaccctctgggaaaggggcaggtgacaggtatttatcagtcagtgcctctctagctcttgtaggaagaagcacacgcaggatggagtctagaggatgagcgatattgactagcaattcatgggctccctccagcagtgcgagggtcagagtttctggagccttgggaggaggcatccctgtgagggggggttagggagatgggagggcaccaggaaaagtgattagaagtcaggtatgggaaggctaaataggacagagtcgagtacatctctgcttggaaaaacatatcaacacccttttttttgatcattatatcttgttcataaaagaaaactttccacattgttttaacaaaccccacagctgagagtcaggcctgaatctttgatgtgtgcccattcacaacgttgaccctattggtttgtggtggggcaggacatcgaagatatcattgactcatcacattcccctgaatagctcatatttagaaaatattcttagattgtaaaaatgtactgttcatttgttatatgcaatcttttaaatgttttatactttaaacaaggcatagttacaagtataaaacataaatatcccaaagccattatgcatggcactcaagattaaaatgggaaataatacatctaataaatcaaatgttccaagacttcaaatgtcttttggaaacaggctatgtaaaacagcacactggtttcaaactttggtaaattttaagaagaactcttacaaaggcatttaattcttatacataattttcaggggaactaatcaaatcagctaatcatgaagacatgattttcgttttagaaaacacttttgaaaacttgggataatctcatgtcttaatgatcaaagcattatgagaaggacagtggttttttacctgggcacactttctaacacatttactctccactattcgtactctggtagccatgttaaccccatcagagattccttctcaagccatgtctcagagctgataggcatcccagcaagttttgcagctcacaatttttctgtaaattacttattctataaaattggaagaggccataaactttggagggccctagaccaattttttggattatttctggtctactctcattccgttgatgatcttagatattctctgcattaaatatcacctctaggctgagaaatccaccaaaaaatatttctagctcagcgttttcctccaaatcttcaatggaagatcataatgtgaactctgcatctccatgttaaagtttaatggacattcacacttagcatgtctcaaagaaatctcatgtaaaccatggccatcctgttctaccttaactttctgagtctatggaatgataatttcacatctcataaacttgactgatgtaagtgtcaagaaaagattgacattttgttaaaacttcgtagccaagtgtgtaacgcttaagcagactttcatatttcaaatctctatagcacgtgtaactcttttttcaagatgtgaaataatcattaggtcagtcatttgtaaatagtacggctgctgtgggctttttccagttcttcaccatccatttttataaaactcttattgttaaaaaaaaaaagttactcagaatttcataaagccaaacacctgatttcaggaacacttgagatgtaagaaaattttatagggacctccaatcactaattttcctattttttctctcaaagaaatgctgaagggaggaattcaggttgaatgaaaggaaatagtaacttacagccatatagagttataaagacttcttgtaaatgtgaacatatggtaaaatataaaaacatgtatttttgaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:1646 -> Molecular function: GO:0004032 [alditol:NADP+ 1-oxidoreductase activity] evidence: IDA
            GeneID:1646 -> Molecular function: GO:0004958 [prostaglandin F receptor activity] evidence: IDA
            GeneID:1646 -> Molecular function: GO:0016655 [oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor] evidence: IDA
            GeneID:1646 -> Molecular function: GO:0018636 [phenanthrene 9,10-monooxygenase activity] evidence: IDA
            GeneID:1646 -> Molecular function: GO:0031406 [carboxylic acid binding] evidence: IDA
            GeneID:1646 -> Molecular function: GO:0032052 [bile acid binding] evidence: IDA
            GeneID:1646 -> Molecular function: GO:0047026 [androsterone dehydrogenase (A-specific) activity] evidence: IEA
            GeneID:1646 -> Molecular function: GO:0047086 [ketosteroid monooxygenase activity] evidence: IDA
            GeneID:1646 -> Molecular function: GO:0047115 [trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity] evidence: IDA
            GeneID:1646 -> Biological process: GO:0006693 [prostaglandin metabolic process] evidence: IDA
            GeneID:1646 -> Biological process: GO:0007186 [G-protein coupled receptor signaling pathway] evidence: IDA
            GeneID:1646 -> Biological process: GO:0007586 [digestion] evidence: IDA
            GeneID:1646 -> Biological process: GO:0008202 [steroid metabolic process] evidence: IDA
            GeneID:1646 -> Biological process: GO:0008284 [positive regulation of cell proliferation] evidence: IDA
            GeneID:1646 -> Biological process: GO:0034694 [response to prostaglandin stimulus] evidence: IDA
            GeneID:1646 -> Biological process: GO:0042448 [progesterone metabolic process] evidence: IDA
            GeneID:1646 -> Biological process: GO:0044597 [daunorubicin metabolic process] evidence: IMP
            GeneID:1646 -> Biological process: GO:0044598 [doxorubicin metabolic process] evidence: IMP
            GeneID:1646 -> Biological process: GO:0051897 [positive regulation of protein kinase B signaling cascade] evidence: IDA
            GeneID:1646 -> Biological process: GO:0055114 [oxidation-reduction process] evidence: IDA
            GeneID:1646 -> Biological process: GO:0071395 [cellular response to jasmonic acid stimulus] evidence: IDA
            GeneID:1646 -> Cellular component: GO:0005737 [cytoplasm] evidence: IEA
ANNOTATIONS from NCBI Entrez Gene (20130726):
            NP_995317 -> EC 1.1.1.213
            NP_995317 -> EC 1.3.1.20

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.