GGRNA Home | Help | Advanced search

2020-10-26 18:52:07, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_199185               1362 bp    mRNA    linear   PRI 07-JUL-2013
DEFINITION  Homo sapiens nucleophosmin (nucleolar phosphoprotein B23, numatrin)
            (NPM1), transcript variant 2, mRNA.
ACCESSION   NM_199185
VERSION     NM_199185.3  GI:262331548
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1362)
  AUTHORS   Zhu,H., Vishwamitra,D., Curry,C.V., Manshouri,R., Diao,L., Khan,A.
            and Amin,H.M.
  TITLE     NPM-ALK up-regulates iNOS expression through a
            STAT3/microRNA-26a-dependent mechanism
  JOURNAL   J. Pathol. 230 (1), 82-94 (2013)
   PUBMED   23338972
  REMARK    GeneRIF: Our investigation of the mechanisms underlying the
            decrease in miR-26a in this lymphoma revealed novel evidence that
            STAT3, a major downstream substrate of NPM-ALK tyrosine kinase
            activity, suppresses MIR26A1 gene expression.
REFERENCE   2  (bases 1 to 1362)
  AUTHORS   Sportoletti,P., Varasano,E., Rossi,R., Bereshchenko,O.,
            Cecchini,D., Gionfriddo,I., Bolli,N., Tiacci,E., Intermesoli,T.,
            Zanghi,P., Masciulli,A., Martelli,M.P., Falzetti,F., Martelli,M.F.
            and Falini,B.
  TITLE     The human NPM1 mutation A perturbs megakaryopoiesis in a
            conditional mouse model
  JOURNAL   Blood 121 (17), 3447-3458 (2013)
   PUBMED   23435463
  REMARK    GeneRIF: NPM1 mutation perturbs megakaryopoiesis and is associated
            with acute myeloid leukemia.
REFERENCE   3  (bases 1 to 1362)
  AUTHORS   Pratcorona M, Brunet S, Nomdedeu J, Ribera JM, Tormo M, Duarte R,
            Escoda L, Guardia R, Queipo de Llano MP, Salamero O, Bargay J,
            Pedro C, Marti JM, Torrebadell M, Diaz-Beya M, Camos M, Colomer D,
            Hoyos M, Sierra J and Esteve J.
  CONSRTM   Grupo Cooperativo Para el Estudio y Tratamiento de las Leucemias
            Agudas Mieloblasticas
  TITLE     Favorable outcome of patients with acute myeloid leukemia harboring
            a low-allelic burden FLT3-ITD mutation and concomitant NPM1
            mutation: relevance to post-remission therapy
  JOURNAL   Blood 121 (14), 2734-2738 (2013)
   PUBMED   23377436
  REMARK    GeneRIF: Effect of FLT3 burden is modulated by NPM1 mutation,
            especially in patients with a low ratio.
REFERENCE   4  (bases 1 to 1362)
  AUTHORS   Yatsenko,Y., Kalennik,O., Maschan,M., Kalinina,I., Maschan,A. and
            Nasedkina,T.
  TITLE     NPM1, FLT3, and c-KIT mutations in pediatric acute myeloid leukemia
            in Russian population
  JOURNAL   J. Pediatr. Hematol. Oncol. 35 (3), E100-E108 (2013)
   PUBMED   23511494
  REMARK    GeneRIF: NPM1 mutations are associated with better complete
            remission in pediatric acute myeloid leukemia.
REFERENCE   5  (bases 1 to 1362)
  AUTHORS   Ando,K., Tsushima,H., Matsuo,E., Horio,K., Tominaga-Sato,S.,
            Imanishi,D., Imaizumi,Y., Iwanaga,M., Itonaga,H., Yoshida,S.,
            Hata,T., Moriuchi,R., Kiyoi,H., Nimer,S., Mano,H., Naoe,T.,
            Tomonaga,M. and Miyazaki,Y.
  TITLE     Mutations in the nucleolar phosphoprotein, nucleophosmin, promote
            the expression of the oncogenic transcription factor MEF/ELF4 in
            leukemia cells and potentiates transformation
  JOURNAL   J. Biol. Chem. 288 (13), 9457-9467 (2013)
   PUBMED   23393136
  REMARK    GeneRIF: enhanced HDM2 expression induced by mutant NPM1 may have a
            role in MEF/ELF4-dependent leukemogenesis
REFERENCE   6  (bases 1 to 1362)
  AUTHORS   Fankhauser,C., Izaurralde,E., Adachi,Y., Wingfield,P. and
            Laemmli,U.K.
  TITLE     Specific complex of human immunodeficiency virus type 1 rev and
            nucleolar B23 proteins: dissociation by the Rev response element
  JOURNAL   Mol. Cell. Biol. 11 (5), 2567-2575 (1991)
   PUBMED   2017166
REFERENCE   7  (bases 1 to 1362)
  AUTHORS   Venkatesh,L.K., Mohammed,S. and Chinnadurai,G.
  TITLE     Functional domains of the HIV-1 rev gene required for
            trans-regulation and subcellular localization
  JOURNAL   Virology 176 (1), 39-47 (1990)
   PUBMED   2109912
REFERENCE   8  (bases 1 to 1362)
  AUTHORS   Cochrane,A.W., Perkins,A. and Rosen,C.A.
  TITLE     Identification of sequences important in the nucleolar localization
            of human immunodeficiency virus Rev: relevance of nucleolar
            localization to function
  JOURNAL   J. Virol. 64 (2), 881-885 (1990)
   PUBMED   2404140
REFERENCE   9  (bases 1 to 1362)
  AUTHORS   Zhang,X.X., Thomis,D.C. and Samuel,C.E.
  TITLE     Isolation and characterization of a molecular cDNA clone of a human
            mRNA from interferon-treated cells encoding nucleolar protein B23,
            numatrin
  JOURNAL   Biochem. Biophys. Res. Commun. 164 (1), 176-184 (1989)
   PUBMED   2478125
REFERENCE   10 (bases 1 to 1362)
  AUTHORS   Chan,P.K., Chan,W.Y., Yung,B.Y., Cook,R.G., Aldrich,M.B., Ku,D.,
            Goldknopf,I.L. and Busch,H.
  TITLE     Amino acid sequence of a specific antigenic peptide of protein B23
  JOURNAL   J. Biol. Chem. 261 (30), 14335-14341 (1986)
   PUBMED   2429957
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff in
            collaboration with Francesco Amaldi. The reference sequence was
            derived from AC091980.4, BC009623.2 and AC093246.3.
            On Nov 3, 2009 this sequence version replaced gi:83641867.
            
            Summary: This gene encodes a phosphoprotein which moves between the
            nucleus and the cytoplasm. The gene product is thought to be
            involved in several processes including regulation of the ARF/p53
            pathway. A number of genes are fusion partners have been
            characterized, in particular the anaplastic lymphoma kinase gene on
            chromosome 2. Mutations in this gene are associated with acute
            myeloid leukemia. More than a dozen pseudogenes of this gene have
            been identified. Alternative splicing results in multiple
            transcript variants.[provided by RefSeq, Nov 2009].
            
            Transcript Variant: This variant (2) lacks an alternate in-frame
            exon, compared to variant 1, resulting in a shorter protein
            (isoform 2) that lacks an internal segment, compared to isoform 1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC009623.2, AL537010.3 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025082 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-153               AC091980.4         138097-138249
            154-1207            BC009623.2         35-1088
            1208-1208           AC093246.3         84342-84342         c
            1209-1362           BC009623.2         1089-1242
FEATURES             Location/Qualifiers
     source          1..1362
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="5"
                     /map="5q35.1"
     gene            1..1362
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /note="nucleophosmin (nucleolar phosphoprotein B23,
                     numatrin)"
                     /db_xref="GeneID:4869"
                     /db_xref="HGNC:7910"
                     /db_xref="HPRD:01246"
                     /db_xref="MIM:164040"
     exon            1..303
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /inference="alignment:Splign:1.39.8"
     variation       49
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:75828148"
     variation       127
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:374925391"
     variation       138
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:10069429"
     variation       142
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148722569"
     variation       147
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112023099"
     variation       149
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:112330400"
     variation       152
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:377340416"
     variation       170..171
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11551528"
     variation       171
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:28411385"
     variation       182
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:180887715"
     variation       183..184
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:11551579"
     variation       183
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:185295288"
     variation       190
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:189577643"
     variation       192
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111426800"
     variation       197
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11551555"
     variation       198
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11551547"
     variation       203
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:375152584"
     variation       204
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11551556"
     variation       210
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200132495"
     variation       218
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202010899"
     variation       221
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11551523"
     variation       225
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35747006"
     variation       232
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11551571"
     variation       242
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370439209"
     variation       243
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:368504792"
     CDS             246..1043
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /note="isoform 2 is encoded by transcript variant 2;
                     nucleophosmin/nucleoplasmin family, member 1; nucleolar
                     protein NO38"
                     /codon_start=1
                     /product="nucleophosmin isoform 2"
                     /protein_id="NP_954654.1"
                     /db_xref="GI:40353734"
                     /db_xref="CCDS:CCDS4377.1"
                     /db_xref="GeneID:4869"
                     /db_xref="HGNC:7910"
                     /db_xref="HPRD:01246"
                     /db_xref="MIM:164040"
                     /translation="
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
"
     misc_feature    255..257
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:03652"
     misc_feature    273..275
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    282..>593
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /note="Nucleoplasmin; Region: Nucleoplasmin; pfam03066"
                     /db_xref="CDD:145949"
     misc_feature    444..446
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    453..455
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    453..455
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    528..530
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    618..620
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    618..620
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    858..860
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:00302"
     misc_feature    867..869
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:00302"
     misc_feature    918..920
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    918..920
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     variation       251
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373962671"
     variation       257
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368150213"
     variation       284
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142254256"
     exon            304..383
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /inference="alignment:Splign:1.39.8"
     variation       312
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35979859"
     exon            384..503
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /inference="alignment:Splign:1.39.8"
     variation       400
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372208958"
     variation       422
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:142102985"
     variation       436
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11551526"
     variation       438
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11551576"
     variation       446
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200294440"
     variation       479
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11551522"
     variation       481
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11551525"
     variation       483
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:17851944"
     variation       502
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147806769"
     exon            504..597
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /inference="alignment:Splign:1.39.8"
     variation       512..513
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:11551553"
     variation       566
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201813873"
     variation       596
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141086340"
     exon            598..704
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /inference="alignment:Splign:1.39.8"
     variation       626
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200558908"
     variation       673
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:375558588"
     exon            705..769
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /inference="alignment:Splign:1.39.8"
     variation       719
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61749648"
     variation       740
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146936311"
     variation       743
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147629377"
     variation       767
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368269652"
     exon            770..827
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /inference="alignment:Splign:1.39.8"
     variation       778
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:17856513"
     variation       785
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140888436"
     variation       788
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61755048"
     variation       815
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368568545"
     variation       823
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183724988"
     exon            828..929
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /inference="alignment:Splign:1.39.8"
     variation       865
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:374517078"
     variation       882
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138586088"
     variation       891
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:143209617"
     variation       904
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377348662"
     variation       920
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:11551532"
     exon            930..1004
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /inference="alignment:Splign:1.39.8"
     variation       935
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371199566"
     variation       970
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:17851431"
     variation       971
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373846371"
     variation       980
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149305908"
     exon            1005..1362
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /inference="alignment:Splign:1.39.8"
     variation       1006
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371956477"
     variation       1017
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17850940"
     variation       1054
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201083444"
     variation       1060
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376359773"
     variation       1066
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:3209214"
     variation       1072
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200638434"
     variation       1079
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1059404"
     variation       1132
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6859650"
     variation       1171
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:183613332"
     variation       1177
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:146200852"
     variation       1208
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:34351976"
     variation       1290
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1059683"
     variation       1317
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:139047811"
     polyA_signal    1336..1341
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
     polyA_site      1362
                     /gene="NPM1"
                     /gene_synonym="B23; NPM"
ORIGIN      
agaaaggagtggggttgaaaagcgcttgcgcaggacggctacggtacgggggtgggagggcttcggagcacgcgcgcggaggcgggacttgggaagcgctcgcgagatcttcagggtctatatataagcgcggggagcctgcgtcctttccctggtgtgattccgtcctgcgcggttgttctctggagcagcgttcttttatctccgtccgccttctctcctacctaagtgcgtgccgccacccgatggaagattcgatggacatggacatgagccccctgaggccccagaactatcttttcggttgtgaactaaaggccgacaaagattatcactttaaggtggataatgatgaaaatgagcaccagttatctttaagaacggtcagtttaggggctggtgcaaaggatgagttgcacattgttgaagcagaggcaatgaattacgaaggcagtccaattaaagtaacactggcaactttgaaaatgtctgtacagccaacggtttcccttgggggctttgaaataacaccaccagtggtcttaaggttgaagtgtggttcagggccagtgcatattagtggacagcacttagtagctgtggaggaagatgcagagtcagaagatgaagaggaggaggatgtgaaactcttaagtatatctggaaagcggtctgcccctggaggtggtagcaaggttccacagaaaaaagtaaaacttgctgctgatgaagatgatgacgatgatgatgaagaggatgatgatgaagatgatgatgatgatgattttgatgatgaggaagctgaagaaaaagcgccagtgaagaaaggacaagaatccttcaagaaacaggaaaaaactcctaaaacaccaaaaggacctagttctgtagaagacattaaagcaaaaatgcaagcaagtatagaaaaaggtggttctcttcccaaagtggaagccaaattcatcaattatgtgaagaattgcttccggatgactgaccaagaggctattcaagatctctggcagtggaggaagtctctttaagaaaatagtttaaacaatttgttaaaaaattttccgtcttatttcatttctgtaacagttgatatctggctgtcctttttataatgcagagtgagaactttccctaccgtgtttgataaatgttgtccaggttctattgccaagaatgtgttgtccaaaatgcctgtttagtttttaaagatggaactccaccctttgcttggttttaagtatgtatggaatgttatgataggacatagtagtagcggtggtcagacatggaaatggtggggagacaaaaatatacatgtgaaataaaactcagtattttaataaagta
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:4869 -> Molecular function: GO:0003713 [transcription coactivator activity] evidence: IDA
            GeneID:4869 -> Molecular function: GO:0003723 [RNA binding] evidence: IDA
            GeneID:4869 -> Molecular function: GO:0004860 [protein kinase inhibitor activity] evidence: IDA
            GeneID:4869 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:4869 -> Molecular function: GO:0019901 [protein kinase binding] evidence: IPI
            GeneID:4869 -> Molecular function: GO:0030957 [Tat protein binding] evidence: IDA
            GeneID:4869 -> Molecular function: GO:0042393 [histone binding] evidence: IDA
            GeneID:4869 -> Molecular function: GO:0042803 [protein homodimerization activity] evidence: IDA
            GeneID:4869 -> Molecular function: GO:0043023 [ribosomal large subunit binding] evidence: IDA
            GeneID:4869 -> Molecular function: GO:0043024 [ribosomal small subunit binding] evidence: IDA
            GeneID:4869 -> Molecular function: GO:0046982 [protein heterodimerization activity] evidence: IMP
            GeneID:4869 -> Molecular function: GO:0051059 [NF-kappaB binding] evidence: IDA
            GeneID:4869 -> Molecular function: GO:0051059 [NF-kappaB binding] evidence: ISS
            GeneID:4869 -> Molecular function: GO:0051082 [unfolded protein binding] evidence: IDA
            GeneID:4869 -> Molecular function: GO:0051082 [unfolded protein binding] evidence: ISS
            GeneID:4869 -> Biological process: GO:0006281 [DNA repair] evidence: IDA
            GeneID:4869 -> Biological process: GO:0006334 [nucleosome assembly] evidence: IDA
            GeneID:4869 -> Biological process: GO:0006334 [nucleosome assembly] evidence: TAS
            GeneID:4869 -> Biological process: GO:0006886 [intracellular protein transport] evidence: TAS
            GeneID:4869 -> Biological process: GO:0006913 [nucleocytoplasmic transport] evidence: IDA
            GeneID:4869 -> Biological process: GO:0006913 [nucleocytoplasmic transport] evidence: TAS
            GeneID:4869 -> Biological process: GO:0006950 [response to stress] evidence: IMP
            GeneID:4869 -> Biological process: GO:0007098 [centrosome cycle] evidence: IMP
            GeneID:4869 -> Biological process: GO:0007098 [centrosome cycle] evidence: ISS
            GeneID:4869 -> Biological process: GO:0007165 [signal transduction] evidence: NAS
            GeneID:4869 -> Biological process: GO:0007569 [cell aging] evidence: IMP
            GeneID:4869 -> Biological process: GO:0007569 [cell aging] evidence: ISS
            GeneID:4869 -> Biological process: GO:0008104 [protein localization] evidence: IDA
            GeneID:4869 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: IMP
            GeneID:4869 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: ISS
            GeneID:4869 -> Biological process: GO:0010826 [negative regulation of centrosome duplication] evidence: IMP
            GeneID:4869 -> Biological process: GO:0016032 [viral process] evidence: TAS
            GeneID:4869 -> Biological process: GO:0019048 [modulation by virus of host morphology or physiology] evidence: IEA
            GeneID:4869 -> Biological process: GO:0032071 [regulation of endodeoxyribonuclease activity] evidence: IDA
            GeneID:4869 -> Biological process: GO:0034080 [CENP-A containing nucleosome assembly at centromere] evidence: TAS
            GeneID:4869 -> Biological process: GO:0042255 [ribosome assembly] evidence: TAS
            GeneID:4869 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IDA
            GeneID:4869 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: NAS
            GeneID:4869 -> Biological process: GO:0044387 [negative regulation of protein kinase activity by regulation of protein phosphorylation] evidence: IDA
            GeneID:4869 -> Biological process: GO:0045727 [positive regulation of translation] evidence: IDA
            GeneID:4869 -> Biological process: GO:0046599 [regulation of centriole replication] evidence: IMP
            GeneID:4869 -> Biological process: GO:0051092 [positive regulation of NF-kappaB transcription factor activity] evidence: IMP
            GeneID:4869 -> Biological process: GO:0051259 [protein oligomerization] evidence: IDA
            GeneID:4869 -> Biological process: GO:0060699 [regulation of endoribonuclease activity] evidence: IDA
            GeneID:4869 -> Biological process: GO:0060735 [regulation of eIF2 alpha phosphorylation by dsRNA] evidence: IDA
            GeneID:4869 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
            GeneID:4869 -> Cellular component: GO:0005634 [nucleus] evidence: ISS
            GeneID:4869 -> Cellular component: GO:0005654 [nucleoplasm] evidence: IDA
            GeneID:4869 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
            GeneID:4869 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA
            GeneID:4869 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
            GeneID:4869 -> Cellular component: GO:0005737 [cytoplasm] evidence: ISS
            GeneID:4869 -> Cellular component: GO:0005813 [centrosome] evidence: IDA
            GeneID:4869 -> Cellular component: GO:0005813 [centrosome] evidence: ISS
            GeneID:4869 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
            GeneID:4869 -> Cellular component: GO:0030529 [ribonucleoprotein complex] evidence: IDA
            GeneID:4869 -> Cellular component: GO:0031616 [spindle pole centrosome] evidence: IDA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.