2024-04-24 16:11:04, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_198700 4656 bp mRNA linear PRI 24-JUN-2013 DEFINITION Homo sapiens CUGBP, Elav-like family member 1 (CELF1), transcript variant 2, mRNA. ACCESSION NM_198700 VERSION NM_198700.2 GI:289547569 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 4656) AUTHORS Yu,T.X., Rao,J.N., Zou,T., Liu,L., Xiao,L., Ouyang,M., Cao,S., Gorospe,M. and Wang,J.Y. TITLE Competitive binding of CUGBP1 and HuR to occludin mRNA controls its translation and modulates epithelial barrier function JOURNAL Mol. Biol. Cell 24 (2), 85-99 (2013) PUBMED 23155001 REMARK GeneRIF: CUGBP1 represses occludin translation by increasing occludin mRNA recruitment to P-bodies. REFERENCE 2 (bases 1 to 4656) AUTHORS Khaziapoul,S., Pearson,M.J., Pryme,I.F., Stern,B. and Hesketh,J.E. TITLE CUG binding protein 1 binds to a specific region within the human albumin 3' untranslated region JOURNAL Biochem. Biophys. Res. Commun. 426 (4), 539-543 (2012) PUBMED 22982313 REMARK GeneRIF: The results suggest that CUG-BP1 binds to nucleotides 51-100 of the human albumin 3'UTR. In human cells CUG-BP1 binding may thus play a role in regulation of albumin expression and, additionally, it may have a function in post-transcriptional control in CHO cells. REFERENCE 3 (bases 1 to 4656) AUTHORS Chang,E.T., Donahue,J.M., Xiao,L., Cui,Y., Rao,J.N., Turner,D.J., Twaddell,W.S., Wang,J.Y. and Battafarano,R.J. TITLE The RNA-binding protein CUG-BP1 increases survivin expression in oesophageal cancer cells through enhanced mRNA stability JOURNAL Biochem. J. 446 (1), 113-123 (2012) PUBMED 22646166 REMARK GeneRIF: CUG-BP1 is overexpressed in oesophageal cancer cell lines and human oesophageal cancer specimens. CUG-BP1 associates with the 3'-untranslated region of survivin mRNA. REFERENCE 4 (bases 1 to 4656) AUTHORS Beisang,D., Rattenbacher,B., Vlasova-St Louis,I.A. and Bohjanen,P.R. TITLE Regulation of CUG-binding protein 1 (CUGBP1) binding to target transcripts upon T cell activation JOURNAL J. Biol. Chem. 287 (2), 950-960 (2012) PUBMED 22117072 REMARK GeneRIF: CUGBP1 binding to certain GRE-containing target transcripts decreased following T cell activation through activation-dependent phosphorylation of CUGBP1. REFERENCE 5 (bases 1 to 4656) AUTHORS Masuda,A., Andersen,H.S., Doktor,T.K., Okamoto,T., Ito,M., Andresen,B.S. and Ohno,K. TITLE CUGBP1 and MBNL1 preferentially bind to 3' UTRs and facilitate mRNA decay JOURNAL Sci Rep 2, 209 (2012) PUBMED 22355723 REMARK GeneRIF: study suggests that regulation of CUGBP1 and MBNL1 is essential for accurate control of destabilization of a broad spectrum of mRNAs as well as of alternative splicing events REFERENCE 6 (bases 1 to 4656) AUTHORS Michalowski,S., Miller,J.W., Urbinati,C.R., Paliouras,M., Swanson,M.S. and Griffith,J. TITLE Visualization of double-stranded RNAs from the myotonic dystrophy protein kinase gene and interactions with CUG-binding protein JOURNAL Nucleic Acids Res. 27 (17), 3534-3542 (1999) PUBMED 10446244 REFERENCE 7 (bases 1 to 4656) AUTHORS Roberts,R., Timchenko,N.A., Miller,J.W., Reddy,S., Caskey,C.T., Swanson,M.S. and Timchenko,L.T. TITLE Altered phosphorylation and intracellular distribution of a (CUG)n triplet repeat RNA-binding protein in patients with myotonic dystrophy and in myotonin protein kinase knockout mice JOURNAL Proc. Natl. Acad. Sci. U.S.A. 94 (24), 13221-13226 (1997) PUBMED 9371827 REFERENCE 8 (bases 1 to 4656) AUTHORS Timchenko,L.T., Miller,J.W., Timchenko,N.A., DeVore,D.R., Datar,K.V., Lin,L., Roberts,R., Caskey,C.T. and Swanson,M.S. TITLE Identification of a (CUG)n triplet repeat RNA-binding protein and its expression in myotonic dystrophy JOURNAL Nucleic Acids Res. 24 (22), 4407-4414 (1996) PUBMED 8948631 REFERENCE 9 (bases 1 to 4656) AUTHORS Bhagavati,S., Ghatpande,A. and Leung,B. TITLE Identification of two nuclear proteins which bind to RNA CUG repeats: significance for myotonic dystrophy JOURNAL Biochem. Biophys. Res. Commun. 228 (1), 55-62 (1996) PUBMED 8912635 REMARK Erratum:[Biochem Biophys Res Commun. 2008 Jun;370(3):530. Bhagwati, S [corrected to Bhagavati, S]] REFERENCE 10 (bases 1 to 4656) AUTHORS Timchenko,L.T., Timchenko,N.A., Caskey,C.T. and Roberts,R. TITLE Novel proteins with binding specificity for DNA CTG repeats and RNA CUG repeats: implications for myotonic dystrophy JOURNAL Hum. Mol. Genet. 5 (1), 115-121 (1996) PUBMED 8789448 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC090559.7, BC031079.1 and BM737883.1. On Feb 24, 2010 this sequence version replaced gi:38570080. Summary: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]. Transcript Variant: This variant (2) uses a different segment for its 5' UTR and a different internal splice site in its coding region, compared to variant 1. The resulting isoform (2) has an additional internal amino acid compared to isoform 1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC031079.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-177 AC090559.7 118818-118994 c 178-1891 BC031079.1 178-1891 1892-4582 AC090559.7 90475-93165 c 4583-4656 BM737883.1 164-237 FEATURES Location/Qualifiers source 1..4656 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="11" /map="11p11" gene 1..4656 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /note="CUGBP, Elav-like family member 1" /db_xref="GeneID:10658" /db_xref="HGNC:2549" /db_xref="HPRD:03046" /db_xref="MIM:601074" exon 1..191 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /inference="alignment:Splign:1.39.8" misc_feature 133..135 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /note="upstream in-frame stop codon" exon 192..379 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /inference="alignment:Splign:1.39.8" CDS 202..1653 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /note="isoform 2 is encoded by transcript variant 2; CUG RNA-binding protein; embryo deadenylation element binding protein; CUG triplet repeat, RNA binding protein 1; CUG triplet repeat, RNA-binding protein 1; nuclear polyadenylated RNA-binding protein, 50-kD; bruno-like 2; CUG-BP- and ETR-3-like factor 1; CELF-1; CUG-BP1; EDEN-BP homolog; bruno-like protein 2; deadenylation factor CUG-BP; RNA-binding protein BRUNOL-2; CUG triplet repeat RNA-binding protein 1; 50 kDa nuclear polyadenylated RNA-binding protein; embryo deadenylation element-binding protein homolog" /codon_start=1 /product="CUGBP Elav-like family member 1 isoform 2" /protein_id="NP_941989.1" /db_xref="GI:38570081" /db_xref="CCDS:CCDS7939.1" /db_xref="GeneID:10658" /db_xref="HGNC:2549" /db_xref="HPRD:03046" /db_xref="MIM:601074" /translation="
MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY
" misc_feature 250..489 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /note="RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA...; Region: RRM; cd00590" /db_xref="CDD:100104" misc_feature order(256..258,382..384,388..390) /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /note="RNA/DNA binding site [nucleotide binding]; other site" /db_xref="CDD:100104" misc_feature 481..489 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /note="RRM dimerization site [polypeptide binding]; other site" /db_xref="CDD:100104" misc_feature 526..756 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /note="RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA...; Region: RRM; cd00590" /db_xref="CDD:100104" misc_feature order(532..534,649..651,655..657) /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /note="RNA/DNA binding site [nucleotide binding]; other site" /db_xref="CDD:100104" misc_feature 748..756 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /note="RRM dimerization site [polypeptide binding]; other site" /db_xref="CDD:100104" misc_feature 1396..1620 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /note="RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA...; Region: RRM; cd00590" /db_xref="CDD:100104" misc_feature order(1402..1404,1522..1524,1528..1530) /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /note="RNA/DNA binding site [nucleotide binding]; other site" /db_xref="CDD:100104" misc_feature 1612..1620 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /note="RRM dimerization site [polypeptide binding]; other site" /db_xref="CDD:100104" exon 380..462 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /inference="alignment:Splign:1.39.8" exon 463..511 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /inference="alignment:Splign:1.39.8" exon 512..646 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /inference="alignment:Splign:1.39.8" STS 557..700 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /standard_name="MARC_11599-11600:1002739035:1" /db_xref="UniSTS:267239" exon 647..726 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /inference="alignment:Splign:1.39.8" exon 727..888 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /inference="alignment:Splign:1.39.8" exon 889..952 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /inference="alignment:Splign:1.39.8" exon 953..1081 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /inference="alignment:Splign:1.39.8" STS 1030..1632 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /standard_name="Cugbp1" /db_xref="UniSTS:479088" exon 1082..1195 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /inference="alignment:Splign:1.39.8" exon 1196..1381 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /inference="alignment:Splign:1.39.8" exon 1382..1525 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /inference="alignment:Splign:1.39.8" STS 1401..1516 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /standard_name="X61451" /db_xref="UniSTS:125827" variation 1479 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /replace="g" /replace="t" /db_xref="dbSNP:34097581" exon 1526..1692 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /inference="alignment:Splign:1.39.8" exon 1693..4647 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /inference="alignment:Splign:1.39.8" STS 1742..2380 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /standard_name="CUGBP1_2383" /db_xref="UniSTS:280629" STS 2383..2568 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /standard_name="STS-N31747" /db_xref="UniSTS:38745" variation 3750 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /replace="a" /replace="c" /db_xref="dbSNP:11546837" STS 3783..3913 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /standard_name="RH25600" /db_xref="UniSTS:84245" variation 4010 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /replace="a" /replace="g" /db_xref="dbSNP:1062801" variation 4022 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /replace="a" /replace="g" /db_xref="dbSNP:1062802" STS 4373..4578 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /standard_name="RH36605" /db_xref="UniSTS:82577" variation 4396 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" /replace="c" /replace="t" /db_xref="dbSNP:1044269" polyA_signal 4628..4633 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" polyA_site 4647 /gene="CELF1" /gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR" ORIGIN
atactttgaaaataacagctcttttttgttccctcgtgtgtctcttcccaattgtatccctattgtattttctcatagtatgtttcagcagaaatcaaggtagacgaagtaacctcttgtcctgaattttcatagttgctcattcttaataatggcagcagaagcaacaatgagagtaactacctcctcagctcaaagaaaatgaacggcaccctggaccacccagaccaaccagatcttgatgctatcaagatgtttgtgggccaggttccaaggacctggtctgaaaaggacttgcgggaactcttcgaacagtatggtgctgtgtatgaaatcaacgtcctaagggataggagccaaaacccgcctcagagcaaagggtgctgttttgttacattttacacccgtaaagctgcattagaagctcagaatgctcttcacaacatgaaagtcctcccagggatgcatcaccctatacagatgaaacctgctgacagtgagaagaacaatgcagtggaagacaggaagctgtttattggtatgatttccaagaagtgcactgaaaatgacatccgagtcatgttctcttcgtttggacagattgaagaatgccggatattgcggggacctgatggcctgagccgaggttgtgcatttgtgacttttacaacaagagccatggcacagacggctatcaaggcaatgcaccaagcacagaccatggagggttgctcatcacccatggtggtaaaatttgctgatacacagaaggacaaagaacagaagagaatggcccagcagctccagcagcagatgcagcaaatcagcgcagcatctgtgtggggaaaccttgctggtctaaatactcttggaccccagtatttagcactccttcagcagactgcctcctctgggaacctcaacaccctgagcagcctccacccaatgggagggttgaatgcaatgcagttacagaatttggctgcactagctgctgcagctagtgcagctcagaacacaccaagtggtaccaatgctctcactacatccagcagtcccctcagcgtgctcactagttcagcagggtcctcacctagctctagcagcagtaattctgtcaaccccatagcctcacttggagccctgcagacattagctggagcaacggctggcctcaatgttggctctttggcaggaatggctgctttaaatggtggcctgggcagcagtggcctttccaatggcaccgggagcaccatggaggccctcactcaggcctactcgggtatccagcaatatgctgctgctgcgctccccactctgtacaaccagaatcttctgacacagcagagtattggtgctgctggaagccagaaggaaggtccagagggagccaacctgttcatctaccacctgccccaggagtttggtgatcaggacctgctgcagatgtttatgccctttgggaatgtcgtgtctgccaaggttttcatagacaagcagacaaacctgagcaagtgttttggttttgtaagttacgacaatcctgtttcggcccaagctgccatccagtccatgaacggctttcagattggcatgaagcggcttaaagtgcagctcaaacgttcgaagaatgacagcaagccctactgagcgtgctcccctctgagactggagtgagagggtcttctgattcctgccgtttgttcatcgttgtgcctaaagcatgtcgatgtggcgtcaagtacatcgtccaaatccctgtctcttcagcttctctgatgcttgaactctcacctttgaccttgtgttgacctttgatgctgatgtgtatttttattatgtttgtttctttcttcgtttttttttctttttttctttcctttttttttccttttgtgctgccaaattggttttgctagaacgactgctgaaggggaaatatttaaacttgcatttgaatataaaaaaaatctatttttctagaacttcataagataaccacttgattttgtgattccaattctttgtaattgtcttcagagcagccctactagcacataccgcgtggtgtttgtatttctgtgaacacacagccagtccgtttctaggctttgtttctctgtgtgcttagttttaaagacaactttgaagtaaacaatgaaataaaagatgtcactaaaacctctgaggctcctgagcacattttgctgatacagtctgtggggcttgaggagaccgcatgtattgttctttcttttgtttttcttctgagttctcaactgcggagagcacctgaaccccctttcctttttgaccgcaggctgcactttgggccccagccagccctttttctttttctttttcttttgtggttcttccctggagcgactctggggagtcctggatatcccgcctgccccttcccctcagccccatgcttgttccaacagtctccacagcaaaatgtgatgctttgatttttttgttgttgtttttgtttttgtattgtttttgtgtttttgttttgaattttttcctttcctactaagattatgcccagaaaaaagttttgcatgtttcctgctgtttcttcacaccttcgtatatatcaccttcacctctctgttttctatagtttgtgcaaaaactgatcgatttaaaagggtttcaaagaagctgttttaaattgttgtagggttgattatttttttcaagattgtattgtttaattttgaagtggcaactttctcctctattgcccttagagcgtttgcctgtgcacttagactgtcacttcgtgtggcctccaggtcttaccggggcttccgggaggctggctgctttgctcagagagggtgggaagggggcctggagagacacgagaagcagaggtagagcctagaaggtggcagcaggtgggtaagaggcttatttagcacattaggggcagtgagcacctggaggaaggagggcgctcccaatcacccgtaggaggccatctgcacaccaagcggcaattcacctgctggcgcttttcctaggtgacaagcacaatactacagtcttcacactgtttacagccctgggcaccagccacccggcactggctcttcatcacagctctgctcttgcttagctagtggggtgggggaaagggcagggatttgtttttttaattgggtggagagccaaacagctactgtccctgggtgccaagcaagccagttttttggttccctgagggaaactgaccctcctctcttgtggcaccatccagcctcagggtcttggagacttgagtaagaatgtgagtggagggggagaggtgaggagaggagcacagggtggatctgtggagggaagaggttacagggggaggagctgatgatagatcccacccagacttaagctgctggtgggtgggtgagctgggaagtaggactgtccagggaagggtggagagatgtagctaggggctggggagggggaggtggaagcgctattgagcatcctccacaccaaggttgatgaaggaagggatcccagcagggtttctgctctggggctggcaggttgcctggtattatgcccaaggccgctctgcctgggggaaagggcagccaggcagaggcccagtgtctggtaggctgctgaatttcctggaaggggtgattggatggaaagaggccagaaaccccagcctgagagactgctgtgcaccccacagtctgactgcacagagccgcctctgttggcaggaggcactgaggctccccttcctgtgtattgagaagcagtgtttgccaatatattttgctttcaattccaagaggagctctgggaaaacctgtggataaaaccaaatgccaaatgttggacgttgtttccttttccttttctctctctgattgttttaattgttctgtggtggttttaatggatttgagaccctggagcggcagctgcctttctgatttccagctgctttttgtgaataatttaaaaagaaaaaaaaaaagaaactttacattttggagacaaacctgtgtgagttttttattggtacaaacgttgtatttaacactaggggttttgtacagttttttgccttttctactagaaaacaatgtaaagtgatttcacaatgtgaagagaaaaaaaaattgccactatgaccaaacgcacagtctgttctgcagcaacaacgggattcaatcaactcagtcgtgattcagccgtagaaatgcttttcctttatcttgtttgagcttttcctttctttcctgttttgatttgcaaaagaaaatgtcttttttgtgtgaacttgtgttgtactctgtagaaaattatggattttactttaatggtttaaaaaaaggcaaggagagccctcgtcgcttttcttacctaatcacagagtttgtgtagtgaatttaaaaagaaaaaaaaattgttataagtttggagcaagggagtatgtgtttcaaaggaatctccttcctttttttgtgtgtttttccttttgtcccaatggggaacctaaatctgttttaattgcacagacacatggacaaaaagtcattttgtatctgccaagtgtggtaccttcctttgtttatttgctattaaactgtttgagaagaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:10658 -> Molecular function: GO:0000166 [nucleotide binding] evidence: IEA GeneID:10658 -> Molecular function: GO:0000900 [translation repressor activity, nucleic acid binding] evidence: NAS GeneID:10658 -> Molecular function: GO:0003723 [RNA binding] evidence: IDA GeneID:10658 -> Molecular function: GO:0003729 [mRNA binding] evidence: IDA GeneID:10658 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:10658 -> Molecular function: GO:0031369 [translation initiation factor binding] evidence: IEA GeneID:10658 -> Molecular function: GO:0042835 [BRE binding] evidence: IDA GeneID:10658 -> Biological process: GO:0006376 [mRNA splice site selection] evidence: ISS GeneID:10658 -> Biological process: GO:0006397 [mRNA processing] evidence: TAS GeneID:10658 -> Biological process: GO:0007281 [germ cell development] evidence: NAS GeneID:10658 -> Biological process: GO:0007286 [spermatid development] evidence: IEA GeneID:10658 -> Biological process: GO:0009790 [embryo development] evidence: NAS GeneID:10658 -> Biological process: GO:0016246 [RNA interference] evidence: NAS GeneID:10658 -> Biological process: GO:0040018 [positive regulation of multicellular organism growth] evidence: IEA GeneID:10658 -> Biological process: GO:0043484 [regulation of RNA splicing] evidence: IDA GeneID:10658 -> Cellular component: GO:0005634 [nucleus] evidence: NAS GeneID:10658 -> Cellular component: GO:0005737 [cytoplasm] evidence: IEA GeneID:10658 -> Cellular component: GO:0030529 [ribonucleoprotein complex] evidence: NAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.