Home |
Help |
Advanced search
2024-04-27 09:55:42, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_197965 1502 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens solute carrier family 10 (sodium/bile acid
cotransporter family), member 6 (SLC10A6), mRNA.
ACCESSION NM_197965 XM_293769
VERSION NM_197965.2 GI:225579058
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1502)
AUTHORS Chen,G., Bentley,A., Adeyemo,A., Shriner,D., Zhou,J., Doumatey,A.,
Huang,H., Ramos,E., Erdos,M., Gerry,N., Herbert,A., Christman,M.
and Rotimi,C.
TITLE Genome-wide association study identifies novel loci association
with fasting insulin and insulin resistance in African Americans
JOURNAL Hum. Mol. Genet. 21 (20), 4530-4536 (2012)
PUBMED 22791750
REFERENCE 2 (bases 1 to 1502)
AUTHORS Geyer,J., Doring,B., Meerkamp,K., Ugele,B., Bakhiya,N.,
Fernandes,C.F., Godoy,J.R., Glatt,H. and Petzinger,E.
TITLE Cloning and functional characterization of human sodium-dependent
organic anion transporter (SLC10A6)
JOURNAL J. Biol. Chem. 282 (27), 19728-19741 (2007)
PUBMED 17491011
REFERENCE 3 (bases 1 to 1502)
AUTHORS Geyer,J., Wilke,T. and Petzinger,E.
TITLE The solute carrier family SLC10: more than a family of bile acid
transporters regarding function and phylogenetic relationships
JOURNAL Naunyn Schmiedebergs Arch. Pharmacol. 372 (6), 413-431 (2006)
PUBMED 16541252
REMARK Review article
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
EF437223.1.
On Mar 24, 2009 this sequence version replaced gi:37537551.
##Evidence-Data-START##
Transcript exon combination :: EF437223.1, BC107051.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025085 [ECO:0000348]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-1502 EF437223.1 1-1502
FEATURES Location/Qualifiers
source 1..1502
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="4"
/map="4q21.3"
gene 1..1502
/gene="SLC10A6"
/gene_synonym="SOAT"
/note="solute carrier family 10 (sodium/bile acid
cotransporter family), member 6"
/db_xref="GeneID:345274"
/db_xref="HGNC:30603"
/db_xref="HPRD:11593"
/db_xref="MIM:613366"
exon 1..525
/gene="SLC10A6"
/gene_synonym="SOAT"
/inference="alignment:Splign:1.39.8"
variation complement(24)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="t"
/db_xref="dbSNP:114439274"
variation complement(60)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="g"
/db_xref="dbSNP:376246941"
variation complement(110)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="t"
/db_xref="dbSNP:200490962"
variation complement(111)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="g"
/db_xref="dbSNP:373115683"
misc_feature 134..136
/gene="SLC10A6"
/gene_synonym="SOAT"
/note="upstream in-frame stop codon"
CDS 149..1282
/gene="SLC10A6"
/gene_synonym="SOAT"
/note="sodium-dependent organic anion transporter"
/codon_start=1
/product="solute carrier family 10 member 6"
/protein_id="NP_932069.1"
/db_xref="GI:37537552"
/db_xref="CCDS:CCDS3614.1"
/db_xref="GeneID:345274"
/db_xref="HGNC:30603"
/db_xref="HPRD:11593"
/db_xref="MIM:613366"
/translation="
MRANCSSSSACPANSSEEELPVGLEVHGNLELVFTVVSTVMMGLLMFSLGCSVEIRKLWSHIRRPWGIAVGLLCQFGLMPFTAYLLAISFSLKPVQAIAVLIMGCCPGGTISNIFTFWVDGDMDLSISMTTCSTVAALGMMPLCIYLYTWSWSLQQNLTIPYQNIGITLVCLTIPVAFGVYVNYRWPKQSKIILKIGAVVGGVLLLVVAVAGVVLAKGSWNSDITLLTISFIFPLIGHVTGFLLALFTHQSWQRCRTISLETGAQNIQMCITMLQLSFTAEHLVQMLSFPLAYGLFQLIDGFLIVAAYQTYKRRLKNKHGKKNSGCTEVCHTRKSTSSRETNAFLEVNEEGAITPGPPGPMDCHRALEPVGHITSCE
"
misc_feature 236..1087
/gene="SLC10A6"
/gene_synonym="SOAT"
/note="bile acid transporter; Region: bass; TIGR00841"
/db_xref="CDD:188087"
misc_feature 236..298
/gene="SLC10A6"
/gene_synonym="SOAT"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q3KNW5.2);
transmembrane region"
misc_feature 263..715
/gene="SLC10A6"
/gene_synonym="SOAT"
/note="Sodium Bile acid symporter family; Region: SBF;
pfam01758"
/db_xref="CDD:145094"
misc_feature 350..412
/gene="SLC10A6"
/gene_synonym="SOAT"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q3KNW5.2);
transmembrane region"
misc_feature 440..502
/gene="SLC10A6"
/gene_synonym="SOAT"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q3KNW5.2);
transmembrane region"
misc_feature 548..610
/gene="SLC10A6"
/gene_synonym="SOAT"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q3KNW5.2);
transmembrane region"
misc_feature 626..688
/gene="SLC10A6"
/gene_synonym="SOAT"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q3KNW5.2);
transmembrane region"
misc_feature 734..796
/gene="SLC10A6"
/gene_synonym="SOAT"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q3KNW5.2);
transmembrane region"
misc_feature 827..889
/gene="SLC10A6"
/gene_synonym="SOAT"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q3KNW5.2);
transmembrane region"
misc_feature 947..1003
/gene="SLC10A6"
/gene_synonym="SOAT"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q3KNW5.2);
transmembrane region"
misc_feature 1019..1081
/gene="SLC10A6"
/gene_synonym="SOAT"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q3KNW5.2);
transmembrane region"
STS 149..1282
/gene="SLC10A6"
/gene_synonym="SOAT"
/db_xref="UniSTS:483033"
variation complement(165)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="t"
/db_xref="dbSNP:17694522"
variation complement(181)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="c"
/db_xref="dbSNP:144976549"
variation complement(218)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="g"
/db_xref="dbSNP:202237551"
variation complement(229)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="g"
/replace="t"
/db_xref="dbSNP:200863577"
variation complement(245)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="g"
/db_xref="dbSNP:200542431"
variation complement(260)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="g"
/replace="t"
/db_xref="dbSNP:150585610"
variation complement(300)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="g"
/db_xref="dbSNP:376640232"
variation complement(327)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="g"
/db_xref="dbSNP:373465762"
variation complement(364)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="g"
/db_xref="dbSNP:369732989"
variation complement(383)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="g"
/db_xref="dbSNP:374782349"
variation complement(386)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="g"
/db_xref="dbSNP:200164392"
variation complement(393)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="t"
/db_xref="dbSNP:144287611"
variation complement(396)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="t"
/db_xref="dbSNP:140433007"
variation complement(404)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="t"
/db_xref="dbSNP:201038329"
variation complement(436)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="g"
/db_xref="dbSNP:150562318"
variation complement(468)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="t"
/db_xref="dbSNP:148050314"
variation complement(473)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="g"
/db_xref="dbSNP:144612845"
variation complement(487)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="g"
/db_xref="dbSNP:369966485"
variation complement(488)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="g"
/db_xref="dbSNP:13106574"
variation complement(516)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="t"
/db_xref="dbSNP:368944610"
exon 526..644
/gene="SLC10A6"
/gene_synonym="SOAT"
/inference="alignment:Splign:1.39.8"
variation complement(527)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="g"
/db_xref="dbSNP:200680340"
variation complement(541)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="t"
/db_xref="dbSNP:201408019"
variation complement(556)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="t"
/db_xref="dbSNP:141195238"
variation complement(597)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="g"
/replace="t"
/db_xref="dbSNP:145019888"
variation complement(601)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="t"
/db_xref="dbSNP:201856427"
variation complement(629)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="t"
/db_xref="dbSNP:374917571"
variation complement(637)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="g"
/db_xref="dbSNP:4386565"
exon 645..733
/gene="SLC10A6"
/gene_synonym="SOAT"
/inference="alignment:Splign:1.39.8"
variation complement(647)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="g"
/db_xref="dbSNP:368767682"
variation complement(650)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="g"
/db_xref="dbSNP:142848271"
variation complement(680)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="g"
/replace="t"
/db_xref="dbSNP:199832707"
variation complement(683)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="g"
/db_xref="dbSNP:200815451"
variation complement(685)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="g"
/replace="t"
/db_xref="dbSNP:138240891"
variation complement(702)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="g"
/db_xref="dbSNP:72874286"
variation complement(719)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="c"
/db_xref="dbSNP:140551884"
exon 734..909
/gene="SLC10A6"
/gene_synonym="SOAT"
/inference="alignment:Splign:1.39.8"
variation complement(735)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="t"
/db_xref="dbSNP:113035158"
variation complement(743)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="g"
/db_xref="dbSNP:57559561"
variation complement(758)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="t"
/db_xref="dbSNP:61734716"
variation complement(772)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="c"
/db_xref="dbSNP:368154278"
variation complement(773)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="g"
/db_xref="dbSNP:201421765"
variation complement(775)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="g"
/db_xref="dbSNP:142660121"
variation complement(795)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="t"
/db_xref="dbSNP:373402918"
variation complement(819)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="t"
/db_xref="dbSNP:369294275"
variation complement(870)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="g"
/db_xref="dbSNP:376017123"
variation complement(878)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="t"
/db_xref="dbSNP:147765094"
variation complement(891)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="t"
/db_xref="dbSNP:145639709"
exon 910..1067
/gene="SLC10A6"
/gene_synonym="SOAT"
/inference="alignment:Splign:1.39.8"
variation complement(961)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="g"
/db_xref="dbSNP:200494131"
variation complement(967)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="g"
/db_xref="dbSNP:376790003"
variation complement(1028)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="g"
/db_xref="dbSNP:144273089"
variation complement(1043)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="g"
/db_xref="dbSNP:148636363"
exon 1068..1502
/gene="SLC10A6"
/gene_synonym="SOAT"
/inference="alignment:Splign:1.39.8"
variation complement(1070)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="t"
/db_xref="dbSNP:373961468"
variation complement(1078)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="g"
/db_xref="dbSNP:144953335"
variation complement(1099)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="g"
/db_xref="dbSNP:370848977"
variation complement(1135)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="t"
/db_xref="dbSNP:62305601"
variation complement(1153)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="g"
/db_xref="dbSNP:149919322"
variation complement(1154)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="g"
/db_xref="dbSNP:200983064"
variation complement(1229)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="g"
/db_xref="dbSNP:200406516"
variation complement(1237)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="a"
/replace="c"
/db_xref="dbSNP:376208642"
variation complement(1240)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="g"
/db_xref="dbSNP:139158966"
variation complement(1247)
/gene="SLC10A6"
/gene_synonym="SOAT"
/replace="c"
/replace="t"
/db_xref="dbSNP:146262257"
ORIGIN
ttaggatgaatcaccttgctggccaacagttattggaatgattctccatgtgtgacttcgttgcactattacaaaatgtggcaggatagacctgcccagccattgttgccgatgttcatttgtaatgctgccttaaggagatgaggagatgagagccaattgttccagcagctcagcctgccctgccaacagttcagaggaggagctgccagtgggactggaggtgcatggaaacctggagctcgttttcacagtggtgtccactgtgatgatggggctgctcatgttctctttgggatgttccgtggagatccggaagctgtggtcgcacatcaggagaccctggggcattgctgtgggactgctctgccagtttgggctcatgccttttacagcttatctcctggccattagcttttctctgaagccagtccaagctattgctgttctcatcatgggctgctgcccggggggcaccatctctaacattttcaccttctgggttgatggagatatggatctcagcatcagtatgacaacctgttccaccgtggccgccctgggaatgatgccactctgcatttatctctacacctggtcctggagtcttcagcagaatctcaccattccttatcagaacataggaattacccttgtgtgcctgaccattcctgtggcctttggtgtctatgtgaattacagatggccaaaacaatccaaaatcattctcaagattggggccgttgttggtggggtcctccttctggtggtcgcagttgctggtgtggtcctggcgaaaggatcttggaattcagacatcacccttctgaccatcagtttcatctttcctttgattggccatgtcacgggttttctgctggcactttttacccaccagtcttggcaaaggtgcaggacaatttccttagaaactggagctcagaatattcagatgtgcatcaccatgctccagttatctttcactgctgagcacttggtccagatgttgagtttcccactggcctatggactcttccagctgatagatggatttcttattgttgcagcatatcagacgtacaagaggagattgaagaacaaacatggaaaaaagaactcaggttgcacagaagtctgccatacgaggaaatcgacttcttccagagagaccaatgccttcttggaggtgaatgaagaaggtgccatcactcctgggccaccagggccaatggattgccacagggctctcgagccagttggccacatcacttcatgtgaatagcagggactagctggctggactggcccccttctttttcagtggccagtaaagacagtgtgcagctgacacatgaatcttgttggtagggccagtgtgaatatttaagtgttcaatgttagaatatttatattttcatgtggattgtgaattgtgatgggatcacttttggagattcccatttcagggagtttcttctgggggttaacataacgtatcaatg
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:345274 -> Molecular function: GO:0008508 [bile acid:sodium symporter activity] evidence: IEA
GeneID:345274 -> Molecular function: GO:0043250 [sodium-dependent organic anion transmembrane transporter activity] evidence: IEA
GeneID:345274 -> Biological process: GO:0043251 [sodium-dependent organic anion transport] evidence: IEA
GeneID:345274 -> Biological process: GO:0055085 [transmembrane transport] evidence: TAS
GeneID:345274 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS
GeneID:345274 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.