GGRNA Home | Help | Advanced search

2020-10-24 07:26:03, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_182916               2291 bp    mRNA    linear   PRI 07-JUL-2013
DEFINITION  Homo sapiens tRNA nucleotidyl transferase, CCA-adding, 1 (TRNT1),
            mRNA.
ACCESSION   NM_182916
VERSION     NM_182916.2  GI:155030239
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2291)
  AUTHORS   Hendrickson,S.L., Lautenberger,J.A., Chinn,L.W., Malasky,M.,
            Sezgin,E., Kingsley,L.A., Goedert,J.J., Kirk,G.D., Gomperts,E.D.,
            Buchbinder,S.P., Troyer,J.L. and O'Brien,S.J.
  TITLE     Genetic variants in nuclear-encoded mitochondrial genes influence
            AIDS progression
  JOURNAL   PLoS ONE 5 (9), E12862 (2010)
   PUBMED   20877624
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2291)
  AUTHORS   Nureki,O.
  TITLE     [Dynamic mechanism of CCA-adding polymerization reaction]
  JOURNAL   Seikagaku 80 (5), 429-434 (2008)
   PUBMED   18575231
  REMARK    GeneRIF: is a RNA polymerase which newly adds CCA sequence to tRNA
            3'terminal. This reaction was named as Vice-Anchored Knock-in and
            Lock Dynamics.[review]
            Review article
REFERENCE   3  (bases 1 to 2291)
  AUTHORS   Lizano,E., Schuster,J., Muller,M., Kelso,J. and Morl,M.
  TITLE     A splice variant of the human CCA-adding enzyme with modified
            activity
  JOURNAL   J. Mol. Biol. 366 (4), 1258-1265 (2007)
   PUBMED   17204286
  REMARK    GeneRIF: These findings strongly suggest that the splice variant of
            the human CCA-adding enzyme is expressed in the cell although the
            in vivo function remains unclear.
REFERENCE   4  (bases 1 to 2291)
  AUTHORS   Augustin,M.A., Reichert,A.S., Betat,H., Huber,R., Morl,M. and
            Steegborn,C.
  TITLE     Crystal structure of the human CCA-adding enzyme: insights into
            template-independent polymerization
  JOURNAL   J. Mol. Biol. 328 (5), 985-994 (2003)
   PUBMED   12729736
  REMARK    GeneRIF: The crystal structure reveals a four domain architecture
            with a cluster of conserved residues forming a positively charged
            cleft between the first two domains.
REFERENCE   5  (bases 1 to 2291)
  AUTHORS   Nagaike,T., Suzuki,T., Tomari,Y., Takemoto-Hori,C., Negayama,F.,
            Watanabe,K. and Ueda,T.
  TITLE     Identification and characterization of mammalian mitochondrial tRNA
            nucleotidyltransferases
  JOURNAL   J. Biol. Chem. 276 (43), 40041-40049 (2001)
   PUBMED   11504732
REFERENCE   6  (bases 1 to 2291)
  AUTHORS   Reichert,A.S., Thurlow,D.L. and Morl,M.
  TITLE     A eubacterial origin for the human tRNA nucleotidyltransferase?
  JOURNAL   Biol. Chem. 382 (10), 1431-1438 (2001)
   PUBMED   11727826
  REMARK    GeneRIF: human gene transcript CGI-47 (#AF151805) was cloned and
            encodes a bona fide CCA-adding enzyme and not a poly(A) polymerase.
REFERENCE   7  (bases 1 to 2291)
  AUTHORS   Simpson,J.C., Wellenreuther,R., Poustka,A., Pepperkok,R. and
            Wiemann,S.
  TITLE     Systematic subcellular localization of novel proteins identified by
            large-scale cDNA sequencing
  JOURNAL   EMBO Rep. 1 (3), 287-292 (2000)
   PUBMED   11256614
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DB032432.1, AB063105.1, DA884423.1, AL834397.1, BQ722111.1 and
            DB525237.1.
            On Aug 10, 2007 this sequence version replaced gi:41281989.
            
            Summary: The CCA-adding enzyme TRNT1 (EC 2.7.7.25) is an essential
            enzyme that catalyzes the addition of the CCA terminus to the
            3-prime end of tRNA precursors. This reaction is a fundamental
            prerequisite for mature tRNAs to become aminoacylated and to
            participate in protein biosynthesis (Lizano et al., 2007 [PubMed
            17204286]).[supplied by OMIM, Aug 2009].
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK290411.1, AB063105.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025082, ERS025083 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            gene product(s) localized to mito. :: reported by MitoCarta
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-57                DB032432.1         1-57
            58-1049             AB063105.1         1-992
            1050-1432           DA884423.1         196-578
            1433-2019           AL834397.1         1337-1923
            2020-2022           BQ722111.1         849-851
            2023-2273           DB525237.1         186-436
            2274-2291           AL834397.1         2197-2214
FEATURES             Location/Qualifiers
     source          1..2291
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="3"
                     /map="3p25.1"
     gene            1..2291
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /note="tRNA nucleotidyl transferase, CCA-adding, 1"
                     /db_xref="GeneID:51095"
                     /db_xref="HGNC:17341"
                     /db_xref="MIM:612907"
     exon            1..75
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /inference="alignment:Splign:1.39.8"
     variation       27
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:116700990"
     variation       28
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:190141803"
     exon            76..250
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /inference="alignment:Splign:1.39.8"
     variation       80
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112624983"
     misc_feature    88..90
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /note="upstream in-frame stop codon"
     CDS             103..1407
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /EC_number="2.7.7.72"
                     /note="mitochondrial CCA-adding
                     tRNA-nucleotidyltransferase; tRNA-nucleotidyltransferase
                     1, mitochondrial; mt CCA-adding enzyme; mt tRNA
                     CCA-diphosphorylase; mt tRNA adenylyltransferase; mt tRNA
                     CCA-pyrophosphorylase; mitochondrial tRNA nucleotidyl
                     transferase, CCA-adding"
                     /codon_start=1
                     /product="CCA tRNA nucleotidyltransferase 1,
                     mitochondrial"
                     /protein_id="NP_886552.2"
                     /db_xref="GI:155030240"
                     /db_xref="CCDS:CCDS2561.2"
                     /db_xref="GeneID:51095"
                     /db_xref="HGNC:17341"
                     /db_xref="MIM:612907"
                     /translation="
MLRCLYHWHRPVLNRRWSRLCLLKQYLFTMKLQSPEFQSLFTEGLKSLTELFVKENHELRIAGGAVRDLLNGVKPQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITTLRIDVTTDGRHAEVEFTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNKKVRFVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKGLAGISGERIWVELKKILVGNHVNHLIHLIYDLDVAPYIGLPANASLEEFDKVSKNVDGFSPKPVTLLASLFKVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIRKVGISSGKEIGALLQQLREQWKKSGYQMEKDELLSYIKKT
"
     transit_peptide 103..225
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Mitochondrion (Potential); propagated from
                     UniProtKB/Swiss-Prot (Q96Q11.2)"
     misc_feature    220..1401
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /note="tRNA nucleotidyltransferase/poly(A) polymerase
                     [Translation, ribosomal structure and biogenesis]; Region:
                     PcnB; COG0617"
                     /db_xref="CDD:30962"
     mat_peptide     226..1404
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /product="CCA tRNA nucleotidyltransferase 1,
                     mitochondrial"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q96Q11.2)"
     misc_feature    226..636
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /note="Nucleotidyltransferase (NT) domain of ClassII
                     CCA-adding enzymes; Region: NT_ClassII-CCAase; cd05398"
                     /db_xref="CDD:143388"
     misc_feature    order(289..294,301..306,331..333,337..339,424..426,
                     463..465,478..480,550..561,568..570)
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /note="active site"
                     /db_xref="CDD:143388"
     misc_feature    order(289..294,301..303,331..333,337..339,550..558,
                     568..570)
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143388"
     misc_feature    order(331..333,337..339,463..465)
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /note="metal binding triad [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143388"
     misc_feature    748..903
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /note="Probable RNA and SrmB- binding site of polymerase
                     A; Region: PolyA_pol_RNAbd; pfam12627"
                     /db_xref="CDD:204988"
     misc_feature    1300..1302
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q96Q11.2); phosphorylation site"
     misc_feature    1306..1308
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N6-acetyllysine; propagated from
                     UniProtKB/Swiss-Prot (Q96Q11.2); acetylation site"
     variation       122
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202044723"
     variation       167
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:191706901"
     variation       169
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:183596892"
     variation       170
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:334773"
     variation       190
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375274931"
     variation       195
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141005872"
     variation       207
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368274081"
     variation       209
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:138682354"
     variation       235
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:75033443"
     variation       236
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371075348"
     exon            251..444
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /inference="alignment:Splign:1.39.8"
     variation       286
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:150902982"
     variation       333
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:114362638"
     variation       361
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140935012"
     variation       433
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149263693"
     variation       443
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143278715"
     exon            445..583
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /inference="alignment:Splign:1.39.8"
     variation       480
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369781563"
     variation       481
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:200459255"
     variation       485
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148398677"
     variation       489
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371348120"
     variation       546
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:41399044"
     variation       580
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370551439"
     exon            584..710
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /inference="alignment:Splign:1.39.8"
     variation       590
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:146717589"
     variation       594
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150215891"
     variation       602
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145784140"
     variation       608
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:62228636"
     variation       612
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:371733557"
     variation       615
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190423145"
     exon            711..904
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /inference="alignment:Splign:1.39.8"
     variation       726
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:367981406"
     variation       732
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143629126"
     variation       733
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:372027157"
     variation       744
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376042943"
     variation       769
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376974085"
     variation       770
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370011798"
     variation       784
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372627156"
     variation       799
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377218988"
     variation       801
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201260728"
     variation       821
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200021901"
     variation       845
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146909954"
     variation       846
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201105941"
     variation       859
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:369118529"
     variation       861
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373038908"
     variation       882
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150433086"
     variation       883
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:116700675"
     variation       889
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201873697"
     variation       902
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113909075"
     exon            905..1158
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /inference="alignment:Splign:1.39.8"
     variation       911
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:187921784"
     variation       931
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:370699359"
     variation       950
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201174442"
     variation       964
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:147986219"
     variation       988
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374592904"
     variation       1002
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:376431679"
     variation       1047
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150742431"
     variation       1050
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1705805"
     variation       1077
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372604723"
     variation       1115
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377244808"
     variation       1137
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199673739"
     variation       1149
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:62228638"
     exon            1159..2276
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /inference="alignment:Splign:1.39.8"
     variation       1168
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375726663"
     variation       1200
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368371043"
     variation       1316
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:202017054"
     variation       1336
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372367989"
     variation       1348
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199931785"
     variation       1376
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146766859"
     variation       1393
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142642881"
     variation       1394
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150984011"
     variation       1440
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371830913"
     variation       1459
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:115688744"
     variation       1491
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:370590725"
     variation       1508
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140435051"
     variation       1510
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:185263036"
     variation       1656
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:77554992"
     variation       1687
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:369264199"
     variation       1692
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187353748"
     variation       1703
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192546200"
     variation       1741
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147416562"
     variation       1756
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:184877192"
     variation       1775
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78363013"
     variation       1809
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12107469"
     variation       1817
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:139714355"
     variation       1847
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:79659648"
     variation       1892
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149959848"
     variation       1895
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145691293"
     STS             1903..2032
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /standard_name="RH102607"
                     /db_xref="UniSTS:96941"
     variation       1972
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:77346437"
     variation       2020
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:711629"
     variation       2057..2058
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace=""
                     /replace="atta"
                     /db_xref="dbSNP:145143419"
     variation       2058..2059
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace=""
                     /replace="atta"
                     /db_xref="dbSNP:371945051"
     variation       2059..2060
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace=""
                     /replace="ttaa"
                     /db_xref="dbSNP:140769388"
     variation       2069..2070
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace=""
                     /replace="a"
                     /replace="atta"
                     /db_xref="dbSNP:55994366"
     variation       2070
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:188468103"
     variation       2071..2072
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace=""
                     /replace="aat"
                     /db_xref="dbSNP:71301177"
     variation       2072
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:373459766"
     variation       2081..2082
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace=""
                     /replace="aaac"
                     /db_xref="dbSNP:373974701"
     variation       2127
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148513565"
     variation       2136..2137
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace=""
                     /replace="atta"
                     /db_xref="dbSNP:368142879"
     variation       2151
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74407198"
     variation       2165..2166
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace=""
                     /replace="ctgt"
                     /db_xref="dbSNP:371355502"
     polyA_signal    2190..2195
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
     variation       2205..2206
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace=""
                     /replace="tatt"
                     /db_xref="dbSNP:201166570"
     variation       2210..2211
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace=""
                     /replace="aagatttattctctaaaga"
                     /db_xref="dbSNP:138799543"
     variation       2211
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:199628389"
     variation       2212
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200853200"
     polyA_site      2213
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
     variation       2215..2216
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace=""
                     /replace="tattctctaaagatt"
                     /db_xref="dbSNP:141431257"
     variation       2215
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:112473748"
     variation       2216..2217
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace=""
                     /replace="tatatattctctaaagatt"
                     /db_xref="dbSNP:72028037"
     variation       2221
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:200421735"
     variation       2222
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200952425"
     variation       2223..2228
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace=""
                     /replace="aaagatttattctctaaag"
                     /db_xref="dbSNP:6147688"
     variation       2223
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201907513"
     variation       2224..2225
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace=""
                     /replace="aaagatttattctctaaag"
                     /replace="aaga"
                     /replace="aagatttattctctaaaga"
                     /db_xref="dbSNP:34338926"
     variation       2229..2230
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace=""
                     /replace="aagatttattctctaaaga"
                     /db_xref="dbSNP:72364197"
     variation       2231..2232
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace=""
                     /replace="attc"
                     /replace="attctctaaagaaagattt"
                     /replace="attctctaaagattt"
                     /db_xref="dbSNP:11273850"
     variation       2232..2233
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace=""
                     /replace="attctctaaagaaagattt"
                     /db_xref="dbSNP:71799368"
     variation       2232
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370319131"
     polyA_signal    2257..2262
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
     polyA_site      2276
                     /gene="TRNT1"
                     /gene_synonym="CCA1; CGI-47; MtCCA"
ORIGIN      
gttggtgacgtcaccgcgttcaccagcccggaagtgcgcgtggcggcggtggcggctgcggcaacagcggggccgatgtgtagttggtgactgcctctccagatgctgaggtgcctgtatcattggcacaggccagtgctgaaccgtaggtggagtaggctgtgccttctgaagcagtatctattcacaatgaagttgcagtctcccgaattccagtcacttttcacagaaggactgaagagtctgacagaattatttgtcaaagagaatcacgaattaagaatagcaggaggagcagtgagggatttattaaatggagtaaagcctcaggatatagattttgccaccactgctacccctactcaaatgaaggagatgtttcagtcggctgggattcggatgataaacaacagaggagaaaagcacggaacaattactgccaggcttcatgaagaaaattttgagattactacactacggattgatgtcaccactgatggaagacatgctgaggtagaatttacaactgactggcagaaagatgcggaacgcagagatctcactataaattctatgtttttaggttttgatggcactttatttgactactttaatggttatgaagatttaaaaaataagaaagttagatttgttggacatgctaaacagagaatacaagaggattatcttagaattttaagatacttcaggttttatgggagaattgtagacaaacctggtgaccatgatcctgagactttggaagcaattgcagaaaatgcaaaaggcttggctggaatatcaggagaaaggatttgggtggaactgaaaaaaattcttgttggtaaccatgtaaatcatttgattcaccttatctatgatcttgatgtggctccttatataggtttacctgctaatgcaagtttagaagaatttgacaaagtcagtaaaaatgttgatggtttttcaccaaagccagtgactcttttggcctcattattcaaagtacaagatgatgtcacaaaattggatttgaggttgaagatcgcaaaagaggagaaaaaccttggcttatttatagttaaaaataggaaagatttaattaaagcaacagatagttcagacccattgaaaccctatcaagacttcattatagattctagggaacctgatgcaactactcgtgtatgtgaactactgaagtaccaaggagagcactgtctcctaaaggaaatgcagcagtggtccattcctccatttcctgtaagtggccatgacatcagaaaagtgggcatttcttcaggaaaagaaattggggctctattacaacagttgcgagaacagtggaaaaaaagtggttaccaaatggaaaaagatgaacttctgagttacataaagaagacctaaaactgatggctactaaaaagcagagcatttctggtaagactaaattttctcccctccctcttaatgaggttttagagactacaccagaataaaagacagtttaggggacctctgtagaacaacaagggtcttattttgtgaattatatatttcaagaactaaacagagatccacctttctggatctgatttatatcactgaaatgtacagttcttttggaatagtttcacctgagaaaacatagttggctattatctatcttaacctgttcaggcttttaaaaaaaactgtttttgcatagggtagtactaagatcttaaaaagtggtaactgtcttgaagaaaaaacgtttattgtttgtttgcaattgaaataacagggttaccttaacaatgactgtctatgatgtgtcagttcttatctgaattccaaaataaacctgtgcttaaaaaagaaataattgaccaagtaagtttgcataaaatgtgaatactaaatgtgtccccagttgctggcattcatatgtacaggatttgttctagcaagctatgcttcagtatgtggttgatatttttctgtcacaatgatttctttatgcatgcagagcctggggaagtcatgggattaacttgagggtcactattgagcctattaattaattattgttttaataaaacaaacattggtattggaagataaatatgtttatgtggtatctgacaatgtgtattaggtgtcatatacaatggtaatatgcctgtctttaaagtgttattttattaattaaaaggatatggctattattatatattctctaaagatttgagtcctaaatgctttcatcaggtaaataaaatgtataatacaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:51095 -> Molecular function: GO:0000049 [tRNA binding] evidence: IDA
            GeneID:51095 -> Molecular function: GO:0004810 [tRNA adenylyltransferase activity] evidence: IDA
            GeneID:51095 -> Molecular function: GO:0005524 [ATP binding] evidence: TAS
            GeneID:51095 -> Molecular function: GO:0009022 [tRNA nucleotidyltransferase activity] evidence: IEA
            GeneID:51095 -> Molecular function: GO:0052927 [CTP:tRNA cytidylyltransferase activity] evidence: IEA
            GeneID:51095 -> Molecular function: GO:0052928 [CTP:3'-cytidine-tRNA cytidylyltransferase activity] evidence: IEA
            GeneID:51095 -> Molecular function: GO:0052929 [ATP:3'-cytidine-cytidine-tRNA adenylyltransferase activity] evidence: IEA
            GeneID:51095 -> Biological process: GO:0001680 [tRNA 3'-terminal CCA addition] evidence: IEA
            GeneID:51095 -> Biological process: GO:0006626 [protein targeting to mitochondrion] evidence: TAS
            GeneID:51095 -> Biological process: GO:0042780 [tRNA 3'-end processing] evidence: IDA
            GeneID:51095 -> Cellular component: GO:0005622 [intracellular] evidence: IDA
            GeneID:51095 -> Cellular component: GO:0005739 [mitochondrion] evidence: IDA
            GeneID:51095 -> Cellular component: GO:0005813 [centrosome] evidence: IDA
ANNOTATIONS from NCBI Entrez Gene (20130726):
            NP_886552 -> EC 2.7.7.72

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.