GGRNA Home | Help | Advanced search

2024-04-25 09:36:16, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_178429                594 bp    mRNA    linear   PRI 18-APR-2013
DEFINITION  Homo sapiens late cornified envelope 2C (LCE2C), mRNA.
ACCESSION   NM_178429
VERSION     NM_178429.3  GI:444299644
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 594)
  AUTHORS   Jackson,B., Tilli,C.M., Hardman,M.J., Avilion,A.A., MacLeod,M.C.,
            Ashcroft,G.S. and Byrne,C.
  TITLE     Late cornified envelope family in differentiating
            epithelia--response to calcium and ultraviolet irradiation
  JOURNAL   J. Invest. Dermatol. 124 (5), 1062-1070 (2005)
   PUBMED   15854049
  REMARK    GeneRIF: paper describing nomenclature changes and expression in
            range of tissues and in response to UV
REFERENCE   2  (bases 1 to 594)
  AUTHORS   Marshall,D., Hardman,M.J., Nield,K.M. and Byrne,C.
  TITLE     Differentially expressed late constituents of the epidermal
            cornified envelope
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 98 (23), 13031-13036 (2001)
   PUBMED   11698679
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BC125197.1 and AL139247.12.
            On Jan 30, 2013 this sequence version replaced gi:57242770.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC125197.1 [ECO:0000332]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-428               BC125197.1         1-428
            429-594             AL139247.12        75896-76061
FEATURES             Location/Qualifiers
     source          1..594
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1q21.3"
     gene            1..594
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /note="late cornified envelope 2C"
                     /db_xref="GeneID:353140"
                     /db_xref="HGNC:29460"
                     /db_xref="HPRD:13972"
                     /db_xref="MIM:612611"
     exon            1..14
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /inference="alignment:Splign:1.39.8"
     exon            15..594
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    21..23
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /note="upstream in-frame stop codon"
     variation       34
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144044997"
     variation       35
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:12073860"
     CDS             36..368
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /note="late envelope protein 11"
                     /codon_start=1
                     /product="late cornified envelope protein 2C"
                     /protein_id="NP_848516.1"
                     /db_xref="GI:30410047"
                     /db_xref="CCDS:CCDS1019.1"
                     /db_xref="GeneID:353140"
                     /db_xref="HGNC:29460"
                     /db_xref="HPRD:13972"
                     /db_xref="MIM:612611"
                     /translation="
MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGSCCGPSSGGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC
"
     variation       59
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:375637333"
     variation       65
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149738089"
     variation       68
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370080975"
     variation       71
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199844975"
     variation       92
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200214001"
     variation       125
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:4119578"
     variation       131
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4119577"
     variation       137
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:4119576"
     variation       138
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:143679302"
     variation       143
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:373855134"
     variation       163
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:142388668"
     variation       187
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:76844826"
     variation       194
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:146579685"
     variation       195
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:74477310"
     variation       221
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150478080"
     variation       229
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200818973"
     variation       250
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:41305072"
     variation       251
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:12074920"
     variation       268
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:146169820"
     variation       271
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199701090"
     variation       283
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12064325"
     variation       302
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139907033"
     variation       303
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201281384"
     variation       305
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:373454559"
     variation       310
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200801335"
     variation       321
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:199924989"
     variation       327
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:139225775"
     variation       331
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371378636"
     variation       332
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:149959514"
     variation       348
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373720601"
     variation       392
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374512784"
     variation       397
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:377446144"
     variation       403
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368735730"
     variation       407
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370841976"
     variation       417
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375022910"
     variation       418
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199779088"
     variation       476
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74685751"
     variation       486
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:181063713"
     variation       489
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146311590"
     variation       494
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12060809"
     variation       594
                     /gene="LCE2C"
                     /gene_synonym="LEP11"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139502253"
ORIGIN      
tgcgtgtgaccagggttgactaaactcctgccagcatgtcttgccagcaaaaccagcagcagtgccagccccctcccaagtgtcctcccaagtgtaccccaaaatgtccacctaagtgtccccccaaatgcccaccacagtgcccagctccatgtttccctgcagtctcttcttgctgtggtcccagctctgggagctgctgtggtcccagctctgggggctgctgcagctctggggctggtggctgctccctgagccaccacaggccccgtctcttccaccggcgccggcaccagagccccgactgctgtgagagtgaaccttctgggggctctggctgctgccacagctctgggggctgctgctgacctgggctacagaagagctcttgggactgaatggccaagaacctgctacggcctgatggatactctttccacttcctctcattccattcattggttggcagagaccacaaagactcatggggctttcctggaagaacttcgtgcttgatgtaacaccccaattgcaagtcttcttttcctcctttacctcatgttataataaagctctgatctctgactcactaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:353140 -> Biological process: GO:0031424 [keratinization] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.