GGRNA Home | Help | Advanced search

2024-04-25 16:21:38, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_178356                388 bp    mRNA    linear   PRI 13-APR-2013
DEFINITION  Homo sapiens late cornified envelope 4A (LCE4A), mRNA.
ACCESSION   NM_178356 XM_003846614
VERSION     NM_178356.2  GI:156523273
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 388)
  AUTHORS   Jackson,B., Tilli,C.M., Hardman,M.J., Avilion,A.A., MacLeod,M.C.,
            Ashcroft,G.S. and Byrne,C.
  TITLE     Late cornified envelope family in differentiating
            epithelia--response to calcium and ultraviolet irradiation
  JOURNAL   J. Invest. Dermatol. 124 (5), 1062-1070 (2005)
   PUBMED   15854049
  REMARK    GeneRIF: paper describing nomenclature changes and expression in
            range of tissues and in response to UV
REFERENCE   2  (bases 1 to 388)
  AUTHORS   Marshall,D., Hardman,M.J., Nield,K.M. and Byrne,C.
  TITLE     Differentially expressed late constituents of the epidermal
            cornified envelope
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 98 (23), 13031-13036 (2001)
   PUBMED   11698679
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BC113448.1.
            On or before Jul 26, 2012 this sequence version replaced
            gi:397137914, gi:30387641.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC113448.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..388
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1q21.3"
     gene            1..388
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /note="late cornified envelope 4A"
                     /db_xref="GeneID:199834"
                     /db_xref="HGNC:16613"
                     /db_xref="HPRD:17264"
                     /db_xref="MIM:612618"
     exon            1..388
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /inference="alignment:Splign:1.39.8"
     STS             1..388
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /db_xref="UniSTS:483538"
     variation       15
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144247009"
     variation       21
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1332496"
     CDS             30..329
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /note="small proline rich-like (epidermal differentiation
                     complex) 4A; late envelope protein 8; small
                     proline-rich-like epidermal differentiation complex
                     protein 4A"
                     /codon_start=1
                     /product="late cornified envelope protein 4A"
                     /protein_id="NP_848133.1"
                     /db_xref="GI:30387642"
                     /db_xref="CCDS:CCDS1022.1"
                     /db_xref="GeneID:199834"
                     /db_xref="HGNC:16613"
                     /db_xref="HPRD:17264"
                     /db_xref="MIM:612618"
                     /translation="
MSCQQNQQQCQPPPKCPIPKYPPKCPSKCASSCPPPISSCCGSSSGGCGCCSSEGGGCCLSHHRHHRSHCHRPKSSNCYGSGSGQQSGGSGCCSGGGCC
"
     variation       31
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:151125573"
     variation       38
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:147765240"
     variation       79
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200910232"
     variation       81
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:41268472"
     variation       89
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370378908"
     variation       129
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199807622"
     variation       133
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200796580"
     variation       148
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371078921"
     variation       151
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138799465"
     variation       158..159
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace=""
                     /replace="agctctgggggctgctgt"
                     /db_xref="dbSNP:6143428"
     variation       158
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200890315"
     variation       159..160
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace=""
                     /replace="agctctgggggctgctgt"
                     /db_xref="dbSNP:33921874"
     variation       167
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200223098"
     variation       171..176
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace=""
                     /replace="tgtggt"
                     /db_xref="dbSNP:113617356"
     variation       172..173
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace=""
                     /replace="ctgtagctctgggggctg"
                     /db_xref="dbSNP:11269814"
     variation       173..174
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace=""
                     /replace="ctgtagctctgggggctg"
                     /db_xref="dbSNP:34855202"
     variation       173
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74871420"
     variation       174
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:79268808"
     variation       190
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:118176527"
     variation       197
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:141839549"
     variation       200
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:117220394"
     variation       218
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:375783060"
     variation       226
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199914704"
     variation       247
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185961871"
     variation       278
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375297518"
     variation       313
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:10888510"
     variation       323
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4845465"
     variation       334
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376871904"
     variation       363
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:73011196"
     variation       366
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141892122"
     variation       374
                     /gene="LCE4A"
                     /gene_synonym="LEP8; SPRL4A"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376970394"
ORIGIN      
tcattcaggtttatcgaaattccaccaagatgtcctgccagcagaaccaacagcagtgccagccccctcccaagtgtcctatccccaagtatcccccaaaatgtccctcaaagtgtgcatcctcatgcccacctccaatctcttcctgctgtggctccagctctgggggctgtggttgctgcagctctgagggaggtggctgctgcctgagccaccacagacaccataggtcccactgccacagacccaagagctccaattgctatggcagtggcagtggccagcagtctgggggttctggctgctgctctggagggggctgttgctgacctggaccaggagcagcaccaaaggaattagtgggcgaaggacccattgcagcctggtg
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:199834 -> Biological process: GO:0031424 [keratinization] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.