GGRNA Home | Help | Advanced search

2020-10-26 19:53:05, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_173528               1596 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens chromosome 15 open reading frame 26 (C15orf26), mRNA.
ACCESSION   NM_173528
VERSION     NM_173528.2  GI:148747372
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1596)
  AUTHORS   Gerhard,D.S., Wagner,L., Feingold,E.A., Shenmen,C.M., Grouse,L.H.,
            Schuler,G., Klein,S.L., Old,S., Rasooly,R., Good,P., Guyer,M.,
            Peck,A.M., Derge,J.G., Lipman,D., Collins,F.S., Jang,W., Sherry,S.,
            Feolo,M., Misquitta,L., Lee,E., Rotmistrovsky,K., Greenhut,S.F.,
            Schaefer,C.F., Buetow,K., Bonner,T.I., Haussler,D., Kent,J.,
            Kiekhaus,M., Furey,T., Brent,M., Prange,C., Schreiber,K.,
            Shapiro,N., Bhat,N.K., Hopkins,R.F., Hsie,F., Driscoll,T.,
            Soares,M.B., Casavant,T.L., Scheetz,T.E., Brown-stein,M.J.,
            Usdin,T.B., Toshiyuki,S., Carninci,P., Piao,Y., Dudekula,D.B.,
            Ko,M.S., Kawakami,K., Suzuki,Y., Sugano,S., Gruber,C.E.,
            Smith,M.R., Simmons,B., Moore,T., Waterman,R., Johnson,S.L.,
            Ruan,Y., Wei,C.L., Mathavan,S., Gunaratne,P.H., Wu,J., Garcia,A.M.,
            Hulyk,S.W., Fuh,E., Yuan,Y., Sneed,A., Kowis,C., Hodgson,A.,
            Muzny,D.M., McPherson,J., Gibbs,R.A., Fahey,J., Helton,E.,
            Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M.,
            Madari,A., Young,A.C., Wetherby,K.D., Granite,S.J., Kwong,P.N.,
            Brinkley,C.P., Pearson,R.L., Bouffard,G.G., Blakesly,R.W.,
            Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J.,
            Myers,R.M., Butterfield,Y.S., Griffith,M., Griffith,O.L.,
            Krzywinski,M.I., Liao,N., Morin,R., Palmquist,D., Petrescu,A.S.,
            Skalska,U., Smailus,D.E., Stott,J.M., Schnerch,A., Schein,J.E.,
            Jones,S.J., Holt,R.A., Baross,A., Marra,M.A., Clifton,S.,
            Makowski,K.A., Bosak,S. and Malek,J.
  CONSRTM   MGC Project Team
  TITLE     The status, quality, and expansion of the NIH full-length cDNA
            project: the Mammalian Gene Collection (MGC)
  JOURNAL   Genome Res. 14 (10B), 2121-2127 (2004)
   PUBMED   15489334
  REMARK    Erratum:[Genome Res. 2006 Jun;16(6):804. Morrin, Ryan [corrected to
            Morin, Ryan]]
COMMENT     PREDICTED REFSEQ: This record has not been reviewed and the
            function is unknown. The reference sequence was derived from
            BC062471.1.
            On Jun 10, 2007 this sequence version replaced gi:27734946.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC062471.1, AK307565.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           ERS025082, ERS025084 [ECO:0000350]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1596
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="15"
                     /map="15q25.1"
     gene            1..1596
                     /gene="C15orf26"
                     /note="chromosome 15 open reading frame 26"
                     /db_xref="GeneID:161502"
                     /db_xref="HGNC:26782"
     exon            1..96
                     /gene="C15orf26"
                     /inference="alignment:Splign:1.39.8"
     variation       16
                     /gene="C15orf26"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368612436"
     CDS             28..933
                     /gene="C15orf26"
                     /codon_start=1
                     /product="uncharacterized protein C15orf26"
                     /protein_id="NP_775799.2"
                     /db_xref="GI:148747373"
                     /db_xref="CCDS:CCDS42068.1"
                     /db_xref="GeneID:161502"
                     /db_xref="HGNC:26782"
                     /translation="
MAQNVYGPGVRIGNWNEDVYLEEELMKDFLEKRDKGKLLIQRSRRLKQNLLRPMQLSVTEDGYIHYGDKVMLVNPDDPDTEADVFLRGDLSLCMTPDEIQSHLKDELEVPCGLSAVQAKTPIGRNTFIILSVHRDATGQVLRYGQDFCLGITGGFDNKMLYLSSDHRTLLKSSKRSWLQEVYLTDEVSHVNCWQAAFPDPQLRLEYEGFPVPANAKILINHCHTNRGLAAHRHLFLSTYFGKEAEVVAHTYLDSHRVEKPRNHWMLVTGNPRDASSSMLDLPKPPTEDTRAMEQAMGLDTQ
"
     variation       39
                     /gene="C15orf26"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:140220433"
     variation       89
                     /gene="C15orf26"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:114773212"
     exon            97..186
                     /gene="C15orf26"
                     /inference="alignment:Splign:1.39.8"
     variation       115
                     /gene="C15orf26"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369930089"
     variation       134
                     /gene="C15orf26"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200883144"
     variation       165
                     /gene="C15orf26"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201408375"
     variation       169
                     /gene="C15orf26"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:376810651"
     variation       186
                     /gene="C15orf26"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200174749"
     exon            187..419
                     /gene="C15orf26"
                     /inference="alignment:Splign:1.39.8"
     variation       187
                     /gene="C15orf26"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190354276"
     variation       198
                     /gene="C15orf26"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373978881"
     variation       225
                     /gene="C15orf26"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376487839"
     variation       226
                     /gene="C15orf26"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371319193"
     variation       232
                     /gene="C15orf26"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202012296"
     variation       305
                     /gene="C15orf26"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:202018244"
     variation       314
                     /gene="C15orf26"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201483243"
     variation       342
                     /gene="C15orf26"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371138907"
     variation       343
                     /gene="C15orf26"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374697061"
     variation       356
                     /gene="C15orf26"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201116091"
     variation       369
                     /gene="C15orf26"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367707361"
     variation       370
                     /gene="C15orf26"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200314900"
     variation       376
                     /gene="C15orf26"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200232799"
     exon            420..504
                     /gene="C15orf26"
                     /inference="alignment:Splign:1.39.8"
     variation       452
                     /gene="C15orf26"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:28597950"
     variation       454
                     /gene="C15orf26"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376230696"
     variation       463
                     /gene="C15orf26"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:142998984"
     variation       469
                     /gene="C15orf26"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:192014112"
     variation       480
                     /gene="C15orf26"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183827094"
     exon            505..663
                     /gene="C15orf26"
                     /inference="alignment:Splign:1.39.8"
     variation       543
                     /gene="C15orf26"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:62000988"
     variation       552
                     /gene="C15orf26"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:370597869"
     variation       583
                     /gene="C15orf26"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373575630"
     variation       586
                     /gene="C15orf26"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:376417842"
     variation       587
                     /gene="C15orf26"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:370247437"
     variation       634
                     /gene="C15orf26"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373630462"
     variation       635
                     /gene="C15orf26"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201412100"
     variation       650
                     /gene="C15orf26"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:190017157"
     variation       656
                     /gene="C15orf26"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374548803"
     variation       663
                     /gene="C15orf26"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200582801"
     exon            664..737
                     /gene="C15orf26"
                     /inference="alignment:Splign:1.39.8"
     variation       669
                     /gene="C15orf26"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372647260"
     variation       684
                     /gene="C15orf26"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:374986053"
     variation       698
                     /gene="C15orf26"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369004350"
     variation       703
                     /gene="C15orf26"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372869826"
     variation       704
                     /gene="C15orf26"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202176412"
     variation       737
                     /gene="C15orf26"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199734474"
     exon            738..1575
                     /gene="C15orf26"
                     /inference="alignment:Splign:1.39.8"
     variation       762
                     /gene="C15orf26"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201697249"
     variation       834
                     /gene="C15orf26"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374112195"
     variation       872
                     /gene="C15orf26"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200579527"
     variation       877
                     /gene="C15orf26"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2279997"
     variation       881
                     /gene="C15orf26"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371058800"
     variation       896
                     /gene="C15orf26"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:375754118"
     variation       897
                     /gene="C15orf26"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368195935"
     variation       902
                     /gene="C15orf26"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375383984"
     variation       906
                     /gene="C15orf26"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199517516"
     variation       927
                     /gene="C15orf26"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371766165"
     variation       948
                     /gene="C15orf26"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:375357907"
     variation       967
                     /gene="C15orf26"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148645161"
     variation       1082
                     /gene="C15orf26"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:74028082"
     variation       1161
                     /gene="C15orf26"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187765211"
     variation       1225
                     /gene="C15orf26"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:117649279"
     variation       1239
                     /gene="C15orf26"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371000562"
     variation       1330
                     /gene="C15orf26"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:115579985"
     variation       1379
                     /gene="C15orf26"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12900669"
     variation       1534
                     /gene="C15orf26"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:114424029"
ORIGIN      
ggcccacttgctgaacagcagggagcgatggcgcagaacgtgtatggtccgggagtccggataggcaactggaatgaggatgtctacctggaggaggagctcatgaaagacttcttagagaagagagacaaggggaaacttctcatacagagaagtagaagactaaaacagaatctcttgagaccgatgcaactttccgtaactgaagatggctatattcattacggtgacaaagtgatgcttgtgaatcctgatgatcctgacacagaagctgatgtgtttctgcgtggggacctgagcctgtgtatgactccagatgaaattcagtcccatctgaaagacgaattagaggtaccctgtggcctgagcgcagttcaagccaagaccccaattggcagaaacacttttatcattttgagtgtacacagagatgccactggtcaagtccttagatatgggcaggacttttgcctggggataacaggaggatttgacaacaaaatgttgtatttgtcaagtgaccacaggaccctcctgaaatcgtctaagaggtcttggctccaggaagtgtacctaacagatgaggtctcccatgtgaactgctggcaggctgccttccctgacccccagttacgcctggaatatgaaggcttccccgtcccggcaaatgctaaaattctcatcaatcactgtcacacaaatcggggactggcagcccaccggcatcttttcttaagcacctattttggaaaggaggctgaggttgtagctcacacatacctggattcacatagagttgagaaaccaaggaaccactggatgttggttactgggaatcccagggatgcctcgtcctccatgttggatctgcccaaaccacccacagaggacactcgagccatggagcaggccatgggccttgacacgcagtaacacgccaggcacgtgcatgttttccctggtcccgctctcatcaaatgtagctttaaaagaaattaacaaccttggtcatgcctcaagctatttttgaatcagatgtgggactctctgggcactatattaaaataaagattacattaagattattgaatttgtggtgggagtctagggctgaagaaaaacagctctggagaataattagtatttgaaagtgacaaacaatagccttttgttgataaacaaattctgaagaactcagcttcctctacttatatccttcattgtctacaaggacagtgcgttactttttaaagttatgtctatgtaataaagctgttggacctatactgaatttttggtaccacagtttccctcttgaatgtactaaaacacaaaaaactgacagctctgagctgtggccttaccttggaattaaacatttccacctttgtaaaacatcctatttttgtttctacctttggctttccaggtcaggacctctacctgatcagtaacctattattttgtaatgatttttaagctgcagaatctctaccttgtctttgaaactggcacattagttgtggcacccatgtgattagatagttcctgacaaaataaatgtatgtccttccaaaaaaaaaaaaaaaaaaaaaa
//

Annotations:



by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.