LOCUS       NM_173211               1369 bp    mRNA    linear   PRI 18-JUL-2013
DEFINITION  Homo sapiens TGFB-induced factor homeobox 1 (TGIF1), transcript
            variant 7, mRNA.
ACCESSION   NM_173211
VERSION     NM_173211.1  GI:28178854
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1369)
  AUTHORS   Valton,J., Dupuy,A., Daboussi,F., Thomas,S., Marechal,A.,
            Macmaster,R., Melliand,K., Juillerat,A. and Duchateau,P.
  TITLE     Overcoming transcription activator-like effector (TALE) DNA binding
            domain sensitivity to cytosine methylation
  JOURNAL   J. Biol. Chem. 287 (46), 38427-38432 (2012)
   PUBMED   23019344
  REMARK    GeneRIF: biochemical analysis of how to overcome TALE DNA binding
            domain sensitivity to cytosine methylation
REFERENCE   2  (bases 1 to 1369)
  AUTHORS   Hneino,M., Blirando,K., Buard,V., Tarlet,G., Benderitter,M.,
            Hoodless,P., Francois,A. and Milliat,F.
  TITLE     The TG-interacting factor TGIF1 regulates stress-induced
            proinflammatory phenotype of endothelial cells
  JOURNAL   J. Biol. Chem. 287 (46), 38913-38921 (2012)
   PUBMED   22995913
  REMARK    GeneRIF: TGIF1 plays a role in TNF-alpha- and radiation-induced
            inflammation and it could be a target in limiting this event in the
            vascular compartment
REFERENCE   3  (bases 1 to 1369)
  AUTHORS   Yeh,B.W., Wu,W.J., Li,W.M., Li,C.C., Huang,C.N., Kang,W.Y.,
            Liu,Z.M. and Huang,H.S.
  TITLE     Overexpression of TG-interacting factor is associated with worse
            prognosis in upper urinary tract urothelial carcinoma
  JOURNAL   Am. J. Pathol. 181 (3), 1044-1055 (2012)
   PUBMED   22771156
  REMARK    GeneRIF: TGIF contributes to the progression of urothelial
            carcinoma via the phosphatidylinositol 3-kinase-AKT pathway.
REFERENCE   4  (bases 1 to 1369)
  AUTHORS   Huang,H.S., Liu,Z.M., Chen,P.C., Tseng,H.Y. and Yeh,B.W.
  TITLE     TG-interacting factor-induced superoxide production from NADPH
            oxidase contributes to the migration/invasion of urothelial
            carcinoma
  JOURNAL   Free Radic. Biol. Med. 53 (4), 769-778 (2012)
   PUBMED   22728270
  REMARK    GeneRIF: TGIF can promote cellular migration/invasion activity of
            urothelial carcinoma cells.
REFERENCE   5  (bases 1 to 1369)
  AUTHORS   Ribeiro-Bicudo,L.A., Quiezi,R.G., Guion-Almeida,M.L., Legnaro,C.
            and Richieri-Costa,A.
  TITLE     Exclusion of mutations in TGIF, ALX3, and ALX4 genes in patients
            with the syndrome of frontonasal dysgenesis, callosal agenesis,
            basal encephalocele, and eye anomalies
  JOURNAL   Am. J. Med. Genet. A 158A (5), 1233-1235 (2012)
   PUBMED   22496059
  REMARK    GeneRIF: Exclusion of mutations in TGIF gene in patients with the
            syndrome of frontonasal dysgenesis, callosal agenesis, basal
            encephalocele, and eye anomalies
REFERENCE   6  (bases 1 to 1369)
  AUTHORS   Hamid,R., Patterson,J. and Brandt,S.J.
  TITLE     Genomic structure, alternative splicing and expression of
            TG-interacting factor, in human myeloid leukemia blasts and cell
            lines
  JOURNAL   Biochim. Biophys. Acta 1779 (5), 347-355 (2008)
   PUBMED   18455519
  REMARK    GeneRIF: A detailed description of the TGIF locus characterizing 12
            TGIF splice isoforms.
REFERENCE   7  (bases 1 to 1369)
  AUTHORS   Yang,Y., Hwang,C.K., D'Souza,U.M., Lee,S.H., Junn,E. and
            Mouradian,M.M.
  TITLE     Three-amino acid extension loop homeodomain proteins Meis2 and TGIF
            differentially regulate transcription
  JOURNAL   J. Biol. Chem. 275 (27), 20734-20741 (2000)
   PUBMED   10764806
REFERENCE   8  (bases 1 to 1369)
  AUTHORS   Wotton,D., Lo,R.S., Lee,S. and Massague,J.
  TITLE     A Smad transcriptional corepressor
  JOURNAL   Cell 97 (1), 29-39 (1999)
   PUBMED   10199400
REFERENCE   9  (bases 1 to 1369)
  AUTHORS   Bertolino,E., Reimund,B., Wildt-Perinic,D. and Clerc,R.G.
  TITLE     A novel homeobox protein which recognizes a TGT core and
            functionally interferes with a retinoid-responsive motif
  JOURNAL   J. Biol. Chem. 270 (52), 31178-31188 (1995)
   PUBMED   8537382
REFERENCE   10 (bases 1 to 1369)
  AUTHORS   Overhauser,J., Mitchell,H.F., Zackai,E.H., Tick,D.B., Rojas,K. and
            Muenke,M.
  TITLE     Physical mapping of the holoprosencephaly critical region in
            18p11.3
  JOURNAL   Am. J. Hum. Genet. 57 (5), 1080-1085 (1995)
   PUBMED   7485158
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from D82120.1 and BC031268.1.
            
            Summary: The protein encoded by this gene is a member of the
            three-amino acid loop extension (TALE) superclass of atypical
            homeodomains. TALE homeobox proteins are highly conserved
            transcription regulators. This particular homeodomain binds to a
            previously characterized retinoid X receptor responsive element
            from the cellular retinol-binding protein II promoter. In addition
            to its role in inhibiting 9-cis-retinoic acid-dependent RXR alpha
            transcription activation of the retinoic acid responsive element,
            the protein is an active transcriptional co-repressor of SMAD2 and
            may participate in the transmission of nuclear signals during
            development and in the adult. Mutations in this gene are associated
            with holoprosencephaly type 4, which is a structural anomaly of the
            brain. Alternative splicing has been observed at this locus and
            multiple splice variants encoding distinct isoforms are described.
            [provided by RefSeq, Jul 2013].
            
            Transcript Variant: This variant (7) has an alternate 5' terminal
            exon, which results in a different 5' UTR and a downstream
            translation start codon, compared to variant 1. The resulting
            isoform (d) has a shorter N-terminus, compared to isoform a.
            Variants 5, 6, 7, 8 and 11 encode the same isoform d.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: D82120.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025087 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-277               D82120.1           1-277
            278-1369            BC031268.1         901-1992
FEATURES             Location/Qualifiers
     source          1..1369
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="18"
                     /map="18p11.3"
     gene            1..1369
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /note="TGFB-induced factor homeobox 1"
                     /db_xref="GeneID:7050"
                     /db_xref="HGNC:11776"
                     /db_xref="HPRD:04023"
                     /db_xref="MIM:602630"
     exon            1..83
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /inference="alignment:Splign:1.39.8"
     variation       18
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:11571511"
     misc_feature    29..31
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /note="upstream in-frame stop codon"
     variation       45
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78731166"
     variation       55
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:140437255"
     variation       56
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369280707"
     variation       57
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:572300"
     variation       59
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200375503"
     variation       83
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111488303"
     exon            84..310
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /inference="alignment:Splign:1.39.8"
     variation       98
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199537751"
     variation       115
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148926036"
     variation       127
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145725785"
     CDS             128..886
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /note="isoform d is encoded by transcript variant 7;
                     homeobox protein TGIF1; TALE homeobox TG-interacting
                     factor; transforming growth factor-beta-induced factor;
                     5'-TG-3'-interacting factor 1"
                     /codon_start=1
                     /product="homeobox protein TGIF1 isoform d"
                     /protein_id="NP_775303.1"
                     /db_xref="GI:28178855"
                     /db_xref="CCDS:CCDS11835.1"
                     /db_xref="GeneID:7050"
                     /db_xref="HGNC:11776"
                     /db_xref="HPRD:04023"
                     /db_xref="MIM:602630"
                     /translation="

MDIPLDLSSSAGSGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISETSSVESVMGIKNFMPALEETPFHSCTAGPNPTLGRPLSPKPSSPGSVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKLTA

"
     misc_feature    188..346
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(188..190,317..319,326..331,338..340)
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     misc_feature    order(191..193,251..253,269..271,308..310,314..319,
                     326..331,335..343)
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     variation       150
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:121909066"
     variation       158
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371311801"
     variation       190
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138292737"
     variation       218
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190612205"
     variation       255
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:121909067"
     variation       285
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201903763"
     variation       292
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142830828"
     variation       295
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:146127624"
     variation       304
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148340331"
     variation       308
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141576819"
     exon            311..1357
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /inference="alignment:Splign:1.39.8"
     variation       323
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200996721"
     variation       331
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375583740"
     variation       356
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369440102"
     variation       387
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:28939693"
     variation       394
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:371759253"
     variation       405
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373874366"
     variation       443
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368355194"
     variation       444
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199580307"
     variation       449
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150903614"
     variation       450
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201827806"
     variation       456
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372040025"
     variation       476
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375158323"
     variation       487
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2229337"
     variation       487
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace=""
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376841726"
     variation       492
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145007040"
     variation       510
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:369930850"
     variation       518
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:121909068"
     variation       545
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11571512"
     variation       552
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:121909069"
     variation       554
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4468717"
     variation       555
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2229333"
     variation       556
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2229334"
     variation       563
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372737398"
     variation       580
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148876248"
     variation       627
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374994543"
     variation       640
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:142737563"
     variation       643
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2229335"
     variation       644
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369048137"
     variation       687
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140538911"
     variation       700
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145648169"
     variation       724
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2229336"
     variation       742
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:372881463"
     variation       745
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:4747"
     variation       750
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61756226"
     variation       778
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:141303152"
     variation       790
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:114912664"
     variation       798
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377493356"
     variation       838
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:191769243"
     variation       846
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138915638"
     variation       905
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145621092"
     STS             908..1155
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /standard_name="STS-X89750"
                     /db_xref="UniSTS:67859"
     variation       911
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370491897"
     variation       922
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:75078688"
     STS             984..1244
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /standard_name="RH39275"
                     /db_xref="UniSTS:88834"
     STS             1009..1241
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /standard_name="RH76383"
                     /db_xref="UniSTS:90886"
     variation       1091
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:111818038"
     variation       1109
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11571513"
     variation       1150..1151
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:199685547"
     variation       1150
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:78848135"
     variation       1151
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:77372929"
     variation       1151
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:71366664"
     variation       1159..1160
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:34622075"
     variation       1185
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:76499577"
     variation       1208
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11571514"
     variation       1293
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:115682894"
     variation       1320
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:35602998"
     variation       1327
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:188912525"
     polyA_signal    1336..1341
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
     variation       1337
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192439935"
     polyA_site      1357
                     /gene="TGIF1"
                     /gene_synonym="HPE4; TGIF"
ORIGIN      

cacaacatttccttgtatgtggatagcgtgaaagaagcttgtgatcctgcccccaccctccccaccgccacattttttaaagtgtattgttgcagcatctggcagtgagactgaggatgaggacagcatggacattcccttggacctttcttcatccgctggctcaggcaagagaaggagaaggggcaacctacccaaggagtctgtgcagattcttcgggattggctgtatgagcaccgttacaatgcctatccttcagagcaagaaaaagcgttgctgtcccagcaaacacacctgtctacgctacaggtctgtaactggttcatcaacgcccgccgcaggctcctccctgacatgctgagaaaggatggcaaagatccaaatcagttcacaatttcccgccgtggggccaagatttctgaaacgagctctgtggagtccgtgatgggcatcaaaaacttcatgccagctctagaggagaccccatttcattcctgtacagctgggccaaacccaaccctagggaggccactgtctcctaagccgtcatccccgggatcagttttggctcgtccatcagtgatctgccataccactgtgactgcattgaaagatgtccctttctctctctgccagtcggtcggtgtgggacaaaacacagatatacagcagatagcggccaaaaacttcacagacacctctctcatgtacccagaggacacttgtaaatctggaccaagtacgaatacacagagtggtcttttcaacactcctccccctactccaccggacctcaaccaggacttcagtggatttcagcttctagtggatgttgcactcaaacgggctgcagagatggagcttcaggcaaaacttacagcttaacccattttcaagcaaaacagttctcagaaatgtcatgattgccggggtgaaggcaagagatgaattgcattattttatatattttttattaatatttgcacatgggattgctaaaacagcttcctgttactgagatgtcttcaatggaatacagtcattccaagaactataaacttaaagctactgtagaaacaaagggttttcttttttaaatgtttcttggtagattattcataatgtgagatggttcccaatatcatgtgattttttttttcctccccttccctttttttgttattttttcagactgtgcaatacttagagaacctatagcatcttctcattcccatgtggaacaggatgcccacatactgtctaattaataaattttccattttttttcaaacaagtatgaatctagttggttgatgccttttttttcatgacataataaagtattttctttaaaaaaaaaaaaaaaaa

//

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:7050 -> Molecular function: GO:0003682 [chromatin binding] evidence: IEA
            GeneID:7050 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:7050 -> Molecular function: GO:0003714 [transcription corepressor activity] evidence: TAS
            GeneID:7050 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
            GeneID:7050 -> Molecular function: GO:0070410 [co-SMAD binding] evidence: IEA
            GeneID:7050 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: TAS
            GeneID:7050 -> Biological process: GO:0001843 [neural tube closure] evidence: IEA
            GeneID:7050 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: TAS
            GeneID:7050 -> Biological process: GO:0006367 [transcription initiation from RNA polymerase II promoter] evidence: TAS
            GeneID:7050 -> Biological process: GO:0007179 [transforming growth factor beta receptor signaling pathway] evidence: TAS
            GeneID:7050 -> Biological process: GO:0007275 [multicellular organismal development] evidence: TAS
            GeneID:7050 -> Biological process: GO:0007368 [determination of left/right symmetry] evidence: IEA
            GeneID:7050 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: IEA
            GeneID:7050 -> Biological process: GO:0009953 [dorsal/ventral pattern formation] evidence: IEA
            GeneID:7050 -> Biological process: GO:0010467 [gene expression] evidence: TAS
            GeneID:7050 -> Biological process: GO:0010470 [regulation of gastrulation] evidence: IEA
            GeneID:7050 -> Biological process: GO:0038092 [nodal signaling pathway] evidence: IEA
            GeneID:7050 -> Biological process: GO:0042493 [response to drug] evidence: IEA
            GeneID:7050 -> Biological process: GO:0045666 [positive regulation of neuron differentiation] evidence: IEA
            GeneID:7050 -> Biological process: GO:0048146 [positive regulation of fibroblast proliferation] evidence: IEA
            GeneID:7050 -> Biological process: GO:0048387 [negative regulation of retinoic acid receptor signaling pathway] evidence: IEA
            GeneID:7050 -> Biological process: GO:0060041 [retina development in camera-type eye] evidence: IEA
            GeneID:7050 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS