2024-05-08 22:49:18, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_173211 1369 bp mRNA linear PRI 18-JUL-2013 DEFINITION Homo sapiens TGFB-induced factor homeobox 1 (TGIF1), transcript variant 7, mRNA. ACCESSION NM_173211 VERSION NM_173211.1 GI:28178854 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1369) AUTHORS Valton,J., Dupuy,A., Daboussi,F., Thomas,S., Marechal,A., Macmaster,R., Melliand,K., Juillerat,A. and Duchateau,P. TITLE Overcoming transcription activator-like effector (TALE) DNA binding domain sensitivity to cytosine methylation JOURNAL J. Biol. Chem. 287 (46), 38427-38432 (2012) PUBMED 23019344 REMARK GeneRIF: biochemical analysis of how to overcome TALE DNA binding domain sensitivity to cytosine methylation REFERENCE 2 (bases 1 to 1369) AUTHORS Hneino,M., Blirando,K., Buard,V., Tarlet,G., Benderitter,M., Hoodless,P., Francois,A. and Milliat,F. TITLE The TG-interacting factor TGIF1 regulates stress-induced proinflammatory phenotype of endothelial cells JOURNAL J. Biol. Chem. 287 (46), 38913-38921 (2012) PUBMED 22995913 REMARK GeneRIF: TGIF1 plays a role in TNF-alpha- and radiation-induced inflammation and it could be a target in limiting this event in the vascular compartment REFERENCE 3 (bases 1 to 1369) AUTHORS Yeh,B.W., Wu,W.J., Li,W.M., Li,C.C., Huang,C.N., Kang,W.Y., Liu,Z.M. and Huang,H.S. TITLE Overexpression of TG-interacting factor is associated with worse prognosis in upper urinary tract urothelial carcinoma JOURNAL Am. J. Pathol. 181 (3), 1044-1055 (2012) PUBMED 22771156 REMARK GeneRIF: TGIF contributes to the progression of urothelial carcinoma via the phosphatidylinositol 3-kinase-AKT pathway. REFERENCE 4 (bases 1 to 1369) AUTHORS Huang,H.S., Liu,Z.M., Chen,P.C., Tseng,H.Y. and Yeh,B.W. TITLE TG-interacting factor-induced superoxide production from NADPH oxidase contributes to the migration/invasion of urothelial carcinoma JOURNAL Free Radic. Biol. Med. 53 (4), 769-778 (2012) PUBMED 22728270 REMARK GeneRIF: TGIF can promote cellular migration/invasion activity of urothelial carcinoma cells. REFERENCE 5 (bases 1 to 1369) AUTHORS Ribeiro-Bicudo,L.A., Quiezi,R.G., Guion-Almeida,M.L., Legnaro,C. and Richieri-Costa,A. TITLE Exclusion of mutations in TGIF, ALX3, and ALX4 genes in patients with the syndrome of frontonasal dysgenesis, callosal agenesis, basal encephalocele, and eye anomalies JOURNAL Am. J. Med. Genet. A 158A (5), 1233-1235 (2012) PUBMED 22496059 REMARK GeneRIF: Exclusion of mutations in TGIF gene in patients with the syndrome of frontonasal dysgenesis, callosal agenesis, basal encephalocele, and eye anomalies REFERENCE 6 (bases 1 to 1369) AUTHORS Hamid,R., Patterson,J. and Brandt,S.J. TITLE Genomic structure, alternative splicing and expression of TG-interacting factor, in human myeloid leukemia blasts and cell lines JOURNAL Biochim. Biophys. Acta 1779 (5), 347-355 (2008) PUBMED 18455519 REMARK GeneRIF: A detailed description of the TGIF locus characterizing 12 TGIF splice isoforms. REFERENCE 7 (bases 1 to 1369) AUTHORS Yang,Y., Hwang,C.K., D'Souza,U.M., Lee,S.H., Junn,E. and Mouradian,M.M. TITLE Three-amino acid extension loop homeodomain proteins Meis2 and TGIF differentially regulate transcription JOURNAL J. Biol. Chem. 275 (27), 20734-20741 (2000) PUBMED 10764806 REFERENCE 8 (bases 1 to 1369) AUTHORS Wotton,D., Lo,R.S., Lee,S. and Massague,J. TITLE A Smad transcriptional corepressor JOURNAL Cell 97 (1), 29-39 (1999) PUBMED 10199400 REFERENCE 9 (bases 1 to 1369) AUTHORS Bertolino,E., Reimund,B., Wildt-Perinic,D. and Clerc,R.G. TITLE A novel homeobox protein which recognizes a TGT core and functionally interferes with a retinoid-responsive motif JOURNAL J. Biol. Chem. 270 (52), 31178-31188 (1995) PUBMED 8537382 REFERENCE 10 (bases 1 to 1369) AUTHORS Overhauser,J., Mitchell,H.F., Zackai,E.H., Tick,D.B., Rojas,K. and Muenke,M. TITLE Physical mapping of the holoprosencephaly critical region in 18p11.3 JOURNAL Am. J. Hum. Genet. 57 (5), 1080-1085 (1995) PUBMED 7485158 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from D82120.1 and BC031268.1. Summary: The protein encoded by this gene is a member of the three-amino acid loop extension (TALE) superclass of atypical homeodomains. TALE homeobox proteins are highly conserved transcription regulators. This particular homeodomain binds to a previously characterized retinoid X receptor responsive element from the cellular retinol-binding protein II promoter. In addition to its role in inhibiting 9-cis-retinoic acid-dependent RXR alpha transcription activation of the retinoic acid responsive element, the protein is an active transcriptional co-repressor of SMAD2 and may participate in the transmission of nuclear signals during development and in the adult. Mutations in this gene are associated with holoprosencephaly type 4, which is a structural anomaly of the brain. Alternative splicing has been observed at this locus and multiple splice variants encoding distinct isoforms are described. [provided by RefSeq, Jul 2013]. Transcript Variant: This variant (7) has an alternate 5' terminal exon, which results in a different 5' UTR and a downstream translation start codon, compared to variant 1. The resulting isoform (d) has a shorter N-terminus, compared to isoform a. Variants 5, 6, 7, 8 and 11 encode the same isoform d. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: D82120.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025087 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-277 D82120.1 1-277 278-1369 BC031268.1 901-1992 FEATURES Location/Qualifiers source 1..1369 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="18" /map="18p11.3" gene 1..1369 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /note="TGFB-induced factor homeobox 1" /db_xref="GeneID:7050" /db_xref="HGNC:11776" /db_xref="HPRD:04023" /db_xref="MIM:602630" exon 1..83 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /inference="alignment:Splign:1.39.8" variation 18 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="g" /replace="t" /db_xref="dbSNP:11571511" misc_feature 29..31 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /note="upstream in-frame stop codon" variation 45 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="t" /db_xref="dbSNP:78731166" variation 55 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="c" /db_xref="dbSNP:140437255" variation 56 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="t" /db_xref="dbSNP:369280707" variation 57 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="g" /replace="t" /db_xref="dbSNP:572300" variation 59 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:200375503" variation 83 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="t" /db_xref="dbSNP:111488303" exon 84..310 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /inference="alignment:Splign:1.39.8" variation 98 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="t" /db_xref="dbSNP:199537751" variation 115 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:148926036" variation 127 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="t" /db_xref="dbSNP:145725785" CDS 128..886 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /note="isoform d is encoded by transcript variant 7; homeobox protein TGIF1; TALE homeobox TG-interacting factor; transforming growth factor-beta-induced factor; 5'-TG-3'-interacting factor 1" /codon_start=1 /product="homeobox protein TGIF1 isoform d" /protein_id="NP_775303.1" /db_xref="GI:28178855" /db_xref="CCDS:CCDS11835.1" /db_xref="GeneID:7050" /db_xref="HGNC:11776" /db_xref="HPRD:04023" /db_xref="MIM:602630" /translation="
MDIPLDLSSSAGSGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISETSSVESVMGIKNFMPALEETPFHSCTAGPNPTLGRPLSPKPSSPGSVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKLTA
" misc_feature 188..346 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:28970" misc_feature order(188..190,317..319,326..331,338..340) /gene="TGIF1" /gene_synonym="HPE4; TGIF" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:28970" misc_feature order(191..193,251..253,269..271,308..310,314..319, 326..331,335..343) /gene="TGIF1" /gene_synonym="HPE4; TGIF" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:28970" variation 150 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="g" /db_xref="dbSNP:121909066" variation 158 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="g" /db_xref="dbSNP:371311801" variation 190 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="t" /db_xref="dbSNP:138292737" variation 218 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="t" /db_xref="dbSNP:190612205" variation 255 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="g" /db_xref="dbSNP:121909067" variation 285 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:201903763" variation 292 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:142830828" variation 295 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="c" /db_xref="dbSNP:146127624" variation 304 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:148340331" variation 308 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="t" /db_xref="dbSNP:141576819" exon 311..1357 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /inference="alignment:Splign:1.39.8" variation 323 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="t" /db_xref="dbSNP:200996721" variation 331 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="t" /db_xref="dbSNP:375583740" variation 356 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:369440102" variation 387 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="t" /db_xref="dbSNP:28939693" variation 394 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="t" /db_xref="dbSNP:371759253" variation 405 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:373874366" variation 443 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:368355194" variation 444 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="t" /db_xref="dbSNP:199580307" variation 449 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:150903614" variation 450 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:201827806" variation 456 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:372040025" variation 476 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:375158323" variation 487 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:2229337" variation 487 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="" /replace="a" /replace="g" /db_xref="dbSNP:376841726" variation 492 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:145007040" variation 510 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="g" /db_xref="dbSNP:369930850" variation 518 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:121909068" variation 545 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="t" /db_xref="dbSNP:11571512" variation 552 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="t" /db_xref="dbSNP:121909069" variation 554 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:4468717" variation 555 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:2229333" variation 556 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:2229334" variation 563 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:372737398" variation 580 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:148876248" variation 627 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="g" /db_xref="dbSNP:374994543" variation 640 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="g" /replace="t" /db_xref="dbSNP:142737563" variation 643 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="t" /db_xref="dbSNP:2229335" variation 644 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:369048137" variation 687 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:140538911" variation 700 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="t" /db_xref="dbSNP:145648169" variation 724 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="g" /replace="t" /db_xref="dbSNP:2229336" variation 742 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="g" /replace="t" /db_xref="dbSNP:372881463" variation 745 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="g" /db_xref="dbSNP:4747" variation 750 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="t" /db_xref="dbSNP:61756226" variation 778 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="c" /db_xref="dbSNP:141303152" variation 790 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:114912664" variation 798 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:377493356" variation 838 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:191769243" variation 846 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:138915638" variation 905 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:145621092" STS 908..1155 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /standard_name="STS-X89750" /db_xref="UniSTS:67859" variation 911 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="t" /db_xref="dbSNP:370491897" variation 922 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="g" /replace="t" /db_xref="dbSNP:75078688" STS 984..1244 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /standard_name="RH39275" /db_xref="UniSTS:88834" STS 1009..1241 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /standard_name="RH76383" /db_xref="UniSTS:90886" variation 1091 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="g" /replace="t" /db_xref="dbSNP:111818038" variation 1109 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:11571513" variation 1150..1151 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="" /replace="t" /db_xref="dbSNP:199685547" variation 1150 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="t" /db_xref="dbSNP:78848135" variation 1151 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="t" /db_xref="dbSNP:77372929" variation 1151 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="" /replace="t" /db_xref="dbSNP:71366664" variation 1159..1160 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="" /replace="t" /db_xref="dbSNP:34622075" variation 1185 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="t" /db_xref="dbSNP:76499577" variation 1208 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:11571514" variation 1293 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="g" /db_xref="dbSNP:115682894" variation 1320 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="" /replace="t" /db_xref="dbSNP:35602998" variation 1327 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="c" /replace="t" /db_xref="dbSNP:188912525" polyA_signal 1336..1341 /gene="TGIF1" /gene_synonym="HPE4; TGIF" variation 1337 /gene="TGIF1" /gene_synonym="HPE4; TGIF" /replace="a" /replace="g" /db_xref="dbSNP:192439935" polyA_site 1357 /gene="TGIF1" /gene_synonym="HPE4; TGIF" ORIGIN
cacaacatttccttgtatgtggatagcgtgaaagaagcttgtgatcctgcccccaccctccccaccgccacattttttaaagtgtattgttgcagcatctggcagtgagactgaggatgaggacagcatggacattcccttggacctttcttcatccgctggctcaggcaagagaaggagaaggggcaacctacccaaggagtctgtgcagattcttcgggattggctgtatgagcaccgttacaatgcctatccttcagagcaagaaaaagcgttgctgtcccagcaaacacacctgtctacgctacaggtctgtaactggttcatcaacgcccgccgcaggctcctccctgacatgctgagaaaggatggcaaagatccaaatcagttcacaatttcccgccgtggggccaagatttctgaaacgagctctgtggagtccgtgatgggcatcaaaaacttcatgccagctctagaggagaccccatttcattcctgtacagctgggccaaacccaaccctagggaggccactgtctcctaagccgtcatccccgggatcagttttggctcgtccatcagtgatctgccataccactgtgactgcattgaaagatgtccctttctctctctgccagtcggtcggtgtgggacaaaacacagatatacagcagatagcggccaaaaacttcacagacacctctctcatgtacccagaggacacttgtaaatctggaccaagtacgaatacacagagtggtcttttcaacactcctccccctactccaccggacctcaaccaggacttcagtggatttcagcttctagtggatgttgcactcaaacgggctgcagagatggagcttcaggcaaaacttacagcttaacccattttcaagcaaaacagttctcagaaatgtcatgattgccggggtgaaggcaagagatgaattgcattattttatatattttttattaatatttgcacatgggattgctaaaacagcttcctgttactgagatgtcttcaatggaatacagtcattccaagaactataaacttaaagctactgtagaaacaaagggttttcttttttaaatgtttcttggtagattattcataatgtgagatggttcccaatatcatgtgattttttttttcctccccttccctttttttgttattttttcagactgtgcaatacttagagaacctatagcatcttctcattcccatgtggaacaggatgcccacatactgtctaattaataaattttccattttttttcaaacaagtatgaatctagttggttgatgccttttttttcatgacataataaagtattttctttaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:7050 -> Molecular function: GO:0003682 [chromatin binding] evidence: IEA GeneID:7050 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA GeneID:7050 -> Molecular function: GO:0003714 [transcription corepressor activity] evidence: TAS GeneID:7050 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA GeneID:7050 -> Molecular function: GO:0070410 [co-SMAD binding] evidence: IEA GeneID:7050 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: TAS GeneID:7050 -> Biological process: GO:0001843 [neural tube closure] evidence: IEA GeneID:7050 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: TAS GeneID:7050 -> Biological process: GO:0006367 [transcription initiation from RNA polymerase II promoter] evidence: TAS GeneID:7050 -> Biological process: GO:0007179 [transforming growth factor beta receptor signaling pathway] evidence: TAS GeneID:7050 -> Biological process: GO:0007275 [multicellular organismal development] evidence: TAS GeneID:7050 -> Biological process: GO:0007368 [determination of left/right symmetry] evidence: IEA GeneID:7050 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: IEA GeneID:7050 -> Biological process: GO:0009953 [dorsal/ventral pattern formation] evidence: IEA GeneID:7050 -> Biological process: GO:0010467 [gene expression] evidence: TAS GeneID:7050 -> Biological process: GO:0010470 [regulation of gastrulation] evidence: IEA GeneID:7050 -> Biological process: GO:0038092 [nodal signaling pathway] evidence: IEA GeneID:7050 -> Biological process: GO:0042493 [response to drug] evidence: IEA GeneID:7050 -> Biological process: GO:0045666 [positive regulation of neuron differentiation] evidence: IEA GeneID:7050 -> Biological process: GO:0048146 [positive regulation of fibroblast proliferation] evidence: IEA GeneID:7050 -> Biological process: GO:0048387 [negative regulation of retinoic acid receptor signaling pathway] evidence: IEA GeneID:7050 -> Biological process: GO:0060041 [retina development in camera-type eye] evidence: IEA GeneID:7050 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.