GGRNA Home | Help | Advanced search

2024-04-27 09:46:59, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_170609               1803 bp    mRNA    linear   PRI 11-MAY-2013
DEFINITION  Homo sapiens cysteine-rich secretory protein 1 (CRISP1), transcript
            variant 2, mRNA.
ACCESSION   NM_170609
VERSION     NM_170609.1  GI:25121983
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1803)
  AUTHORS   Legare,C., Boudreau,L., Thimon,V., Thabet,M. and Sullivan,R.
  TITLE     Vasectomy affects cysteine-rich secretory protein expression along
            the human epididymis and its association with ejaculated
            spermatozoa following vasectomy surgical reversal
  JOURNAL   J. Androl. 31 (6), 573-583 (2010)
   PUBMED   20378925
  REMARK    GeneRIF: CRISP1 was in the seminal plasma of normal and
            vasovasostomized men, but not in that of vasectomized men. The
            soluble concentration of CRISP1 was significantly higher in the
            seminal plasma of vasovasostomized men as compared with that from
            normal men.
REFERENCE   2  (bases 1 to 1803)
  AUTHORS   Mungall,A.J., Palmer,S.A., Sims,S.K., Edwards,C.A., Ashurst,J.L.,
            Wilming,L., Jones,M.C., Horton,R., Hunt,S.E., Scott,C.E.,
            Gilbert,J.G., Clamp,M.E., Bethel,G., Milne,S., Ainscough,R.,
            Almeida,J.P., Ambrose,K.D., Andrews,T.D., Ashwell,R.I.,
            Babbage,A.K., Bagguley,C.L., Bailey,J., Banerjee,R., Barker,D.J.,
            Barlow,K.F., Bates,K., Beare,D.M., Beasley,H., Beasley,O.,
            Bird,C.P., Blakey,S., Bray-Allen,S., Brook,J., Brown,A.J.,
            Brown,J.Y., Burford,D.C., Burrill,W., Burton,J., Carder,C.,
            Carter,N.P., Chapman,J.C., Clark,S.Y., Clark,G., Clee,C.M.,
            Clegg,S., Cobley,V., Collier,R.E., Collins,J.E., Colman,L.K.,
            Corby,N.R., Coville,G.J., Culley,K.M., Dhami,P., Davies,J.,
            Dunn,M., Earthrowl,M.E., Ellington,A.E., Evans,K.A., Faulkner,L.,
            Francis,M.D., Frankish,A., Frankland,J., French,L., Garner,P.,
            Garnett,J., Ghori,M.J., Gilby,L.M., Gillson,C.J., Glithero,R.J.,
            Grafham,D.V., Grant,M., Gribble,S., Griffiths,C., Griffiths,M.,
            Hall,R., Halls,K.S., Hammond,S., Harley,J.L., Hart,E.A.,
            Heath,P.D., Heathcott,R., Holmes,S.J., Howden,P.J., Howe,K.L.,
            Howell,G.R., Huckle,E., Humphray,S.J., Humphries,M.D., Hunt,A.R.,
            Johnson,C.M., Joy,A.A., Kay,M., Keenan,S.J., Kimberley,A.M.,
            King,A., Laird,G.K., Langford,C., Lawlor,S., Leongamornlert,D.A.,
            Leversha,M., Lloyd,C.R., Lloyd,D.M., Loveland,J.E., Lovell,J.,
            Martin,S., Mashreghi-Mohammadi,M., Maslen,G.L., Matthews,L.,
            McCann,O.T., McLaren,S.J., McLay,K., McMurray,A., Moore,M.J.,
            Mullikin,J.C., Niblett,D., Nickerson,T., Novik,K.L., Oliver,K.,
            Overton-Larty,E.K., Parker,A., Patel,R., Pearce,A.V., Peck,A.I.,
            Phillimore,B., Phillips,S., Plumb,R.W., Porter,K.M., Ramsey,Y.,
            Ranby,S.A., Rice,C.M., Ross,M.T., Searle,S.M., Sehra,H.K.,
            Sheridan,E., Skuce,C.D., Smith,S., Smith,M., Spraggon,L.,
            Squares,S.L., Steward,C.A., Sycamore,N., Tamlyn-Hall,G., Tester,J.,
            Theaker,A.J., Thomas,D.W., Thorpe,A., Tracey,A., Tromans,A.,
            Tubby,B., Wall,M., Wallis,J.M., West,A.P., White,S.S.,
            Whitehead,S.L., Whittaker,H., Wild,A., Willey,D.J., Wilmer,T.E.,
            Wood,J.M., Wray,P.W., Wyatt,J.C., Young,L., Younger,R.M.,
            Bentley,D.R., Coulson,A., Durbin,R., Hubbard,T., Sulston,J.E.,
            Dunham,I., Rogers,J. and Beck,S.
  TITLE     The DNA sequence and analysis of human chromosome 6
  JOURNAL   Nature 425 (6960), 805-811 (2003)
   PUBMED   14574404
REFERENCE   3  (bases 1 to 1803)
  AUTHORS   Evans,J.P.
  TITLE     The molecular basis of sperm-oocyte membrane interactions during
            mammalian fertilization
  JOURNAL   Hum. Reprod. Update 8 (4), 297-311 (2002)
   PUBMED   12206465
  REMARK    Review article
REFERENCE   4  (bases 1 to 1803)
  AUTHORS   Cuasnicu,P.S., Ellerman,D.A., Cohen,D.J., Busso,D., Morgenfeld,M.M.
            and Da Ros,V.G.
  TITLE     Molecular mechanisms involved in mammalian gamete fusion
  JOURNAL   Arch. Med. Res. 32 (6), 614-618 (2001)
   PUBMED   11750738
  REMARK    Review article
REFERENCE   5  (bases 1 to 1803)
  AUTHORS   Cohen,D.J., Ellerman,D.A., Busso,D., Morgenfeld,M.M., Piazza,A.D.,
            Hayashi,M., Young,E.T., Kasahara,M. and Cuasnicu,P.S.
  TITLE     Evidence that human epididymal protein ARP plays a role in gamete
            fusion through complementary sites on the surface of the human egg
  JOURNAL   Biol. Reprod. 65 (4), 1000-1005 (2001)
   PUBMED   11566719
REFERENCE   6  (bases 1 to 1803)
  AUTHORS   Kirchhoff,C.
  TITLE     Molecular characterization of epididymal proteins
  JOURNAL   Rev. Reprod. 3 (2), 86-95 (1998)
   PUBMED   9685187
  REMARK    Review article
REFERENCE   7  (bases 1 to 1803)
  AUTHORS   Hayashi,M., Fujimoto,S., Takano,H., Ushiki,T., Abe,K., Ishikura,H.,
            Yoshida,M.C., Kirchhoff,C., Ishibashi,T. and Kasahara,M.
  TITLE     Characterization of a human glycoprotein with a potential role in
            sperm-egg fusion: cDNA cloning, immunohistochemical localization,
            and chromosomal assignment of the gene (AEGL1)
  JOURNAL   Genomics 32 (3), 367-374 (1996)
   PUBMED   8838800
REFERENCE   8  (bases 1 to 1803)
  AUTHORS   Kratzschmar,J., Haendler,B., Eberspaecher,U., Roosterman,D.,
            Donner,P. and Schleuning,W.D.
  TITLE     The human cysteine-rich secretory protein (CRISP) family. Primary
            structure and tissue distribution of CRISP-1, CRISP-2 and CRISP-3
  JOURNAL   Eur. J. Biochem. 236 (3), 827-836 (1996)
   PUBMED   8665901
REFERENCE   9  (bases 1 to 1803)
  AUTHORS   Hayashi,M.
  TITLE     [Analysis of the human acidic epididymal glycoprotein-like
            molecule: isolation of cDNA and tissue localization]
  JOURNAL   Hokkaido Igaku Zasshi 70 (5), 743-753 (1995)
   PUBMED   8543280
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from X95238.1 and S80310.1.
            
            Summary: Fertilization consists of a sequence of specific cell-cell
            interactions culminating in the fusion of the sperm and egg plasma
            membranes. Recognition, binding, and fusion occur through the
            interaction of complementary molecules that are localized to
            specific domains of the sperm and egg plasma membranes. In the
            sperm, the postacrosomal region or equatorial segment is involved
            in sperm-egg plasma membrane fusion. The protein encoded by this
            gene is a member of the cysteine-rich secretory protein (CRISP)
            family. It is expressed in the epididymis, is secreted into the
            epididymal lumen, and binds to the postacrosomal region of the
            sperm head, where it plays a role in sperm-egg fusion.
            Alternatively spliced transcript variants encoding different
            isoforms have been found for this gene. [provided by RefSeq, Mar
            2011].
            
            Transcript Variant: This variant (2) lacks an exon in the 3' coding
            region compared to variant 1. This results in a frame-shift, early
            translation termination, and a shorter isoform (2, also known as
            CRISP-1 delta) compared to isoform 1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: X95238.1, BC131707.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           ERS025084, ERS025085 [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..1803
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="6"
                     /map="6p21.3"
     gene            1..1803
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
                     /note="cysteine-rich secretory protein 1"
                     /db_xref="GeneID:167"
                     /db_xref="HGNC:304"
                     /db_xref="HPRD:03118"
                     /db_xref="MIM:601193"
     exon            1..77
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    23..25
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
                     /note="upstream in-frame stop codon"
     STS             60..1089
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
                     /db_xref="UniSTS:486005"
     exon            78..145
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
                     /inference="alignment:Splign:1.39.8"
     CDS             80..616
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
                     /note="isoform 2 precursor is encoded by transcript
                     variant 2; acidic epididymal glycoprotein-like 1;
                     cysteine-rich secretory protein-1 delta; AEG-related
                     protein; AEG-like protein; acidic epididymal glycoprotein
                     homolog"
                     /codon_start=1
                     /product="cysteine-rich secretory protein 1 isoform 2
                     precursor"
                     /protein_id="NP_733758.1"
                     /db_xref="GI:25121984"
                     /db_xref="CCDS:CCDS4932.1"
                     /db_xref="GeneID:167"
                     /db_xref="HGNC:304"
                     /db_xref="HPRD:03118"
                     /db_xref="MIM:601193"
                     /translation="
MEIKHLLFLVAAACLLPMLSMKKKSARDQFNKLVTDLPNVQEEIVNIHNALRRRVVPPASNMLKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSWSSVIGVWYSESTSFKHGEWTTTDDDITTDHYTQIVWATSYLIGCAIASCRQQGSPRYLYVCHYCHD
"
     sig_peptide     80..142
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     mat_peptide     143..613
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
                     /product="cysteine-rich secretory protein 1 isoform 2"
     misc_feature    194..613
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
                     /note="SCP_CRISP: SCP-like extracellular protein domain,
                     CRISP-like sub-family. The wider family of SCP containing
                     proteins includes plant pathogenesis-related protein 1
                     (PR-1), CRISPs, mammalian cysteine-rich secretory
                     proteins, which combine SCP with a...; Region: SCP_CRISP;
                     cd05383"
                     /db_xref="CDD:88562"
     variation       143
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3204891"
     exon            146..274
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
                     /inference="alignment:Splign:1.39.8"
     exon            275..365
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
                     /inference="alignment:Splign:1.39.8"
     exon            366..514
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
                     /inference="alignment:Splign:1.39.8"
     variation       368
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:3209304"
     exon            515..612
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
                     /inference="alignment:Splign:1.39.8"
     exon            613..1799
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
                     /inference="alignment:Splign:1.39.8"
     STS             655..893
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
                     /standard_name="RH80559"
                     /db_xref="UniSTS:90398"
     STS             763..1038
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
                     /standard_name="STS-X95237"
                     /db_xref="UniSTS:36213"
     variation       967
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1053497"
     STS             1095..1198
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
                     /standard_name="AEGL1"
                     /db_xref="UniSTS:479934"
     polyA_signal    1174..1179
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
     polyA_site      1196
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
                     /experiment="experimental evidence, no additional details
                     recorded"
     polyA_signal    1773..1778
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
     variation       1798..1799
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:71002694"
     polyA_site      1799
                     /gene="CRISP1"
                     /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G;
                     HUMARP"
                     /experiment="experimental evidence, no additional details
                     recorded"
ORIGIN      
ttaaaagcacaaatacactacatagagaaaggcttggttcttatcaggacacaaatttaaaggctgtgtggacttggggatggaaattaaacacctcttgtttttggttgctgctgcttgcttactgcctatgttgtccatgaaaaagaaatcagctagagaccaatttaataagctcgtcaccgacttgccaaatgtacaagaagagatcgttaatatacacaacgccctcaggagaagagtagttccaccagccagcaacatgctgaagatgagttggagtgaagaggctgcacaaaatgccagaattttttcaaagtattgtgatatgacagagagcaacccccttgagaggagacttccaaataccttttgtggagaaaatatgcatatgacatcttatcctgtatcatggtcaagtgtaattggagtctggtacagtgagtctacaagtttcaaacatggagaatggacaacaacggatgatgacataactactgaccactacactcagattgtttgggccacatcttacctgattggctgtgccattgcatcttgccgccaacaaggatcacctcgatatctctacgtttgtcactattgtcatgactaacccctgcatctactatgatgaatacttcgactgtgacatacaagtccattatctgggatgcaaccactcaacaactatcctattctgtaaagccacttgtctgtgtgacactgagataaaataggtctttgttattttcaactgttctatgctgtgacgatgaggaggagatgtctgttggattcatgtcttttgctatagttcagtagcttctgctaaatttcactgattttaatcatgctggagaccttaactcccatcctgatacatcctgaagtaacactgttttaaactttcttagtgctggagtaaaaggtcaagtccaacacctgccttaaatttaaatcatgtgatttatagtttttaagttggcataattcaacttatggtataactgggtccctcaacagtaacctgggctaaaataggtcttatgtggttcaactcccacccccgccttccccatattttcaaccactctgattatcttccctgcacaactaacatccagtaataattcttcacttttaaaattttacttctactttaaatcaatcattaaaggaatccacaaagcaaacagagttcagtctcatcttgcaaggtaaatatcatttaattggaagtagtttaaatgtctcattgttttattgacacatctatatatacatttgtgaagcaagaaacaataaaaaagcttcgtatgccattaatttaacaaaatatgtattcagtactgattgcatacaagatgcatgtttatatatatggaaggaatatagtttcatttcattgcaaaggcagtataaaagatatataaaatagcataatatgagaaattaagtccctaaagacatataggtcacatattattattgccagatgagcataaatagcttctgtttggagattcaggaaagccttagggtggaatgaggaacatcttctgagtaaacagggttgcaaaggttatgattatttcaacacaatggaagagcacagttaaggccaactaacgtaaaatgcactgaagccttagggaatattgaagggcctgacatggggaaagggaaggctaaaaatacttggtcaaattttaacattataccaaagttatacccagttctacctacttgtatatttctttactcatttcaataaagtgtttgaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:167 -> Biological process: GO:0007342 [fusion of sperm to egg plasma membrane] evidence: TAS
            GeneID:167 -> Cellular component: GO:0005615 [extracellular space] evidence: TAS

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.