2024-04-27 09:46:59, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_170609 1803 bp mRNA linear PRI 11-MAY-2013 DEFINITION Homo sapiens cysteine-rich secretory protein 1 (CRISP1), transcript variant 2, mRNA. ACCESSION NM_170609 VERSION NM_170609.1 GI:25121983 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1803) AUTHORS Legare,C., Boudreau,L., Thimon,V., Thabet,M. and Sullivan,R. TITLE Vasectomy affects cysteine-rich secretory protein expression along the human epididymis and its association with ejaculated spermatozoa following vasectomy surgical reversal JOURNAL J. Androl. 31 (6), 573-583 (2010) PUBMED 20378925 REMARK GeneRIF: CRISP1 was in the seminal plasma of normal and vasovasostomized men, but not in that of vasectomized men. The soluble concentration of CRISP1 was significantly higher in the seminal plasma of vasovasostomized men as compared with that from normal men. REFERENCE 2 (bases 1 to 1803) AUTHORS Mungall,A.J., Palmer,S.A., Sims,S.K., Edwards,C.A., Ashurst,J.L., Wilming,L., Jones,M.C., Horton,R., Hunt,S.E., Scott,C.E., Gilbert,J.G., Clamp,M.E., Bethel,G., Milne,S., Ainscough,R., Almeida,J.P., Ambrose,K.D., Andrews,T.D., Ashwell,R.I., Babbage,A.K., Bagguley,C.L., Bailey,J., Banerjee,R., Barker,D.J., Barlow,K.F., Bates,K., Beare,D.M., Beasley,H., Beasley,O., Bird,C.P., Blakey,S., Bray-Allen,S., Brook,J., Brown,A.J., Brown,J.Y., Burford,D.C., Burrill,W., Burton,J., Carder,C., Carter,N.P., Chapman,J.C., Clark,S.Y., Clark,G., Clee,C.M., Clegg,S., Cobley,V., Collier,R.E., Collins,J.E., Colman,L.K., Corby,N.R., Coville,G.J., Culley,K.M., Dhami,P., Davies,J., Dunn,M., Earthrowl,M.E., Ellington,A.E., Evans,K.A., Faulkner,L., Francis,M.D., Frankish,A., Frankland,J., French,L., Garner,P., Garnett,J., Ghori,M.J., Gilby,L.M., Gillson,C.J., Glithero,R.J., Grafham,D.V., Grant,M., Gribble,S., Griffiths,C., Griffiths,M., Hall,R., Halls,K.S., Hammond,S., Harley,J.L., Hart,E.A., Heath,P.D., Heathcott,R., Holmes,S.J., Howden,P.J., Howe,K.L., Howell,G.R., Huckle,E., Humphray,S.J., Humphries,M.D., Hunt,A.R., Johnson,C.M., Joy,A.A., Kay,M., Keenan,S.J., Kimberley,A.M., King,A., Laird,G.K., Langford,C., Lawlor,S., Leongamornlert,D.A., Leversha,M., Lloyd,C.R., Lloyd,D.M., Loveland,J.E., Lovell,J., Martin,S., Mashreghi-Mohammadi,M., Maslen,G.L., Matthews,L., McCann,O.T., McLaren,S.J., McLay,K., McMurray,A., Moore,M.J., Mullikin,J.C., Niblett,D., Nickerson,T., Novik,K.L., Oliver,K., Overton-Larty,E.K., Parker,A., Patel,R., Pearce,A.V., Peck,A.I., Phillimore,B., Phillips,S., Plumb,R.W., Porter,K.M., Ramsey,Y., Ranby,S.A., Rice,C.M., Ross,M.T., Searle,S.M., Sehra,H.K., Sheridan,E., Skuce,C.D., Smith,S., Smith,M., Spraggon,L., Squares,S.L., Steward,C.A., Sycamore,N., Tamlyn-Hall,G., Tester,J., Theaker,A.J., Thomas,D.W., Thorpe,A., Tracey,A., Tromans,A., Tubby,B., Wall,M., Wallis,J.M., West,A.P., White,S.S., Whitehead,S.L., Whittaker,H., Wild,A., Willey,D.J., Wilmer,T.E., Wood,J.M., Wray,P.W., Wyatt,J.C., Young,L., Younger,R.M., Bentley,D.R., Coulson,A., Durbin,R., Hubbard,T., Sulston,J.E., Dunham,I., Rogers,J. and Beck,S. TITLE The DNA sequence and analysis of human chromosome 6 JOURNAL Nature 425 (6960), 805-811 (2003) PUBMED 14574404 REFERENCE 3 (bases 1 to 1803) AUTHORS Evans,J.P. TITLE The molecular basis of sperm-oocyte membrane interactions during mammalian fertilization JOURNAL Hum. Reprod. Update 8 (4), 297-311 (2002) PUBMED 12206465 REMARK Review article REFERENCE 4 (bases 1 to 1803) AUTHORS Cuasnicu,P.S., Ellerman,D.A., Cohen,D.J., Busso,D., Morgenfeld,M.M. and Da Ros,V.G. TITLE Molecular mechanisms involved in mammalian gamete fusion JOURNAL Arch. Med. Res. 32 (6), 614-618 (2001) PUBMED 11750738 REMARK Review article REFERENCE 5 (bases 1 to 1803) AUTHORS Cohen,D.J., Ellerman,D.A., Busso,D., Morgenfeld,M.M., Piazza,A.D., Hayashi,M., Young,E.T., Kasahara,M. and Cuasnicu,P.S. TITLE Evidence that human epididymal protein ARP plays a role in gamete fusion through complementary sites on the surface of the human egg JOURNAL Biol. Reprod. 65 (4), 1000-1005 (2001) PUBMED 11566719 REFERENCE 6 (bases 1 to 1803) AUTHORS Kirchhoff,C. TITLE Molecular characterization of epididymal proteins JOURNAL Rev. Reprod. 3 (2), 86-95 (1998) PUBMED 9685187 REMARK Review article REFERENCE 7 (bases 1 to 1803) AUTHORS Hayashi,M., Fujimoto,S., Takano,H., Ushiki,T., Abe,K., Ishikura,H., Yoshida,M.C., Kirchhoff,C., Ishibashi,T. and Kasahara,M. TITLE Characterization of a human glycoprotein with a potential role in sperm-egg fusion: cDNA cloning, immunohistochemical localization, and chromosomal assignment of the gene (AEGL1) JOURNAL Genomics 32 (3), 367-374 (1996) PUBMED 8838800 REFERENCE 8 (bases 1 to 1803) AUTHORS Kratzschmar,J., Haendler,B., Eberspaecher,U., Roosterman,D., Donner,P. and Schleuning,W.D. TITLE The human cysteine-rich secretory protein (CRISP) family. Primary structure and tissue distribution of CRISP-1, CRISP-2 and CRISP-3 JOURNAL Eur. J. Biochem. 236 (3), 827-836 (1996) PUBMED 8665901 REFERENCE 9 (bases 1 to 1803) AUTHORS Hayashi,M. TITLE [Analysis of the human acidic epididymal glycoprotein-like molecule: isolation of cDNA and tissue localization] JOURNAL Hokkaido Igaku Zasshi 70 (5), 743-753 (1995) PUBMED 8543280 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from X95238.1 and S80310.1. Summary: Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. The protein encoded by this gene is a member of the cysteine-rich secretory protein (CRISP) family. It is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head, where it plays a role in sperm-egg fusion. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011]. Transcript Variant: This variant (2) lacks an exon in the 3' coding region compared to variant 1. This results in a frame-shift, early translation termination, and a shorter isoform (2, also known as CRISP-1 delta) compared to isoform 1. ##Evidence-Data-START## Transcript exon combination :: X95238.1, BC131707.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025084, ERS025085 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. FEATURES Location/Qualifiers source 1..1803 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="6" /map="6p21.3" gene 1..1803 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" /note="cysteine-rich secretory protein 1" /db_xref="GeneID:167" /db_xref="HGNC:304" /db_xref="HPRD:03118" /db_xref="MIM:601193" exon 1..77 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" /inference="alignment:Splign:1.39.8" misc_feature 23..25 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" /note="upstream in-frame stop codon" STS 60..1089 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" /db_xref="UniSTS:486005" exon 78..145 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" /inference="alignment:Splign:1.39.8" CDS 80..616 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" /note="isoform 2 precursor is encoded by transcript variant 2; acidic epididymal glycoprotein-like 1; cysteine-rich secretory protein-1 delta; AEG-related protein; AEG-like protein; acidic epididymal glycoprotein homolog" /codon_start=1 /product="cysteine-rich secretory protein 1 isoform 2 precursor" /protein_id="NP_733758.1" /db_xref="GI:25121984" /db_xref="CCDS:CCDS4932.1" /db_xref="GeneID:167" /db_xref="HGNC:304" /db_xref="HPRD:03118" /db_xref="MIM:601193" /translation="
MEIKHLLFLVAAACLLPMLSMKKKSARDQFNKLVTDLPNVQEEIVNIHNALRRRVVPPASNMLKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSWSSVIGVWYSESTSFKHGEWTTTDDDITTDHYTQIVWATSYLIGCAIASCRQQGSPRYLYVCHYCHD
" sig_peptide 80..142 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" /inference="COORDINATES: ab initio prediction:SignalP:4.0" mat_peptide 143..613 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" /product="cysteine-rich secretory protein 1 isoform 2" misc_feature 194..613 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" /note="SCP_CRISP: SCP-like extracellular protein domain, CRISP-like sub-family. The wider family of SCP containing proteins includes plant pathogenesis-related protein 1 (PR-1), CRISPs, mammalian cysteine-rich secretory proteins, which combine SCP with a...; Region: SCP_CRISP; cd05383" /db_xref="CDD:88562" variation 143 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" /replace="a" /replace="g" /db_xref="dbSNP:3204891" exon 146..274 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" /inference="alignment:Splign:1.39.8" exon 275..365 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" /inference="alignment:Splign:1.39.8" exon 366..514 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" /inference="alignment:Splign:1.39.8" variation 368 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:3209304" exon 515..612 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" /inference="alignment:Splign:1.39.8" exon 613..1799 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" /inference="alignment:Splign:1.39.8" STS 655..893 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" /standard_name="RH80559" /db_xref="UniSTS:90398" STS 763..1038 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" /standard_name="STS-X95237" /db_xref="UniSTS:36213" variation 967 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" /replace="c" /replace="t" /db_xref="dbSNP:1053497" STS 1095..1198 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" /standard_name="AEGL1" /db_xref="UniSTS:479934" polyA_signal 1174..1179 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" polyA_site 1196 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" /experiment="experimental evidence, no additional details recorded" polyA_signal 1773..1778 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" variation 1798..1799 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" /replace="" /replace="a" /db_xref="dbSNP:71002694" polyA_site 1799 /gene="CRISP1" /gene_synonym="AEGL1; ARP; CRISP-1; HSCRISP1D; HSCRISP1G; HUMARP" /experiment="experimental evidence, no additional details recorded" ORIGIN
ttaaaagcacaaatacactacatagagaaaggcttggttcttatcaggacacaaatttaaaggctgtgtggacttggggatggaaattaaacacctcttgtttttggttgctgctgcttgcttactgcctatgttgtccatgaaaaagaaatcagctagagaccaatttaataagctcgtcaccgacttgccaaatgtacaagaagagatcgttaatatacacaacgccctcaggagaagagtagttccaccagccagcaacatgctgaagatgagttggagtgaagaggctgcacaaaatgccagaattttttcaaagtattgtgatatgacagagagcaacccccttgagaggagacttccaaataccttttgtggagaaaatatgcatatgacatcttatcctgtatcatggtcaagtgtaattggagtctggtacagtgagtctacaagtttcaaacatggagaatggacaacaacggatgatgacataactactgaccactacactcagattgtttgggccacatcttacctgattggctgtgccattgcatcttgccgccaacaaggatcacctcgatatctctacgtttgtcactattgtcatgactaacccctgcatctactatgatgaatacttcgactgtgacatacaagtccattatctgggatgcaaccactcaacaactatcctattctgtaaagccacttgtctgtgtgacactgagataaaataggtctttgttattttcaactgttctatgctgtgacgatgaggaggagatgtctgttggattcatgtcttttgctatagttcagtagcttctgctaaatttcactgattttaatcatgctggagaccttaactcccatcctgatacatcctgaagtaacactgttttaaactttcttagtgctggagtaaaaggtcaagtccaacacctgccttaaatttaaatcatgtgatttatagtttttaagttggcataattcaacttatggtataactgggtccctcaacagtaacctgggctaaaataggtcttatgtggttcaactcccacccccgccttccccatattttcaaccactctgattatcttccctgcacaactaacatccagtaataattcttcacttttaaaattttacttctactttaaatcaatcattaaaggaatccacaaagcaaacagagttcagtctcatcttgcaaggtaaatatcatttaattggaagtagtttaaatgtctcattgttttattgacacatctatatatacatttgtgaagcaagaaacaataaaaaagcttcgtatgccattaatttaacaaaatatgtattcagtactgattgcatacaagatgcatgtttatatatatggaaggaatatagtttcatttcattgcaaaggcagtataaaagatatataaaatagcataatatgagaaattaagtccctaaagacatataggtcacatattattattgccagatgagcataaatagcttctgtttggagattcaggaaagccttagggtggaatgaggaacatcttctgagtaaacagggttgcaaaggttatgattatttcaacacaatggaagagcacagttaaggccaactaacgtaaaatgcactgaagccttagggaatattgaagggcctgacatggggaaagggaaggctaaaaatacttggtcaaattttaacattataccaaagttatacccagttctacctacttgtatatttctttactcatttcaataaagtgtttgaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:167 -> Biological process: GO:0007342 [fusion of sperm to egg plasma membrane] evidence: TAS GeneID:167 -> Cellular component: GO:0005615 [extracellular space] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.