GGRNA Home | Help | Advanced search

2024-04-26 09:43:24, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_152924               8761 bp    mRNA    linear   PRI 15-JUN-2013
DEFINITION  Homo sapiens abhydrolase domain containing 2 (ABHD2), transcript
            variant 2, mRNA.
ACCESSION   NM_152924
VERSION     NM_152924.4  GI:194473690
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 8761)
  AUTHORS   Comuzzie,A.G., Cole,S.A., Laston,S.L., Voruganti,V.S., Haack,K.,
            Gibbs,R.A. and Butte,N.F.
  TITLE     Novel genetic loci identified for the pathophysiology of childhood
            obesity in the Hispanic population
  JOURNAL   PLoS ONE 7 (12), E51954 (2012)
   PUBMED   23251661
REFERENCE   2  (bases 1 to 8761)
  AUTHORS   Giambra,V., Cianci,R., Lolli,S., Mattioli,C., Tampella,G.,
            Cattalini,M., Kilic,S.S., Pandolfi,F., Plebani,A. and Frezza,D.
  TITLE     Allele *1 of HS1.2 enhancer associates with selective IgA
            deficiency and IgM concentration
  JOURNAL   J. Immunol. 183 (12), 8280-8285 (2009)
   PUBMED   20007591
  REMARK    GeneRIF: Patients with selective immunoglobulin (Ig)A deficiency
            have a highly significant increase of homozygousity of HS1.2 allele
            *1, with an increase of 2.6-fold; the HS1.2 polymorphism influences
            Ig seric production, but not IgG switch.
REFERENCE   3  (bases 1 to 8761)
  AUTHORS   Miyata,K., Nakayama,M., Mizuta,S., Hokimoto,S., Sugamura,K.,
            Oshima,S., Oike,Y., Sugiyama,S., Ogawa,H. and Yamamura,K.
  TITLE     Elevated mature macrophage expression of human ABHD2 gene in
            vulnerable plaque
  JOURNAL   Biochem. Biophys. Res. Commun. 365 (2), 207-213 (2008)
   PUBMED   17980156
  REMARK    GeneRIF: Our results showed that the ABHD2 was expressed in
            atherosclerotic lesions, and that the ABHD2 expression was
            significantly higher in the patients with UA than with SA.
REFERENCE   4  (bases 1 to 8761)
  AUTHORS   Girard,A., Sachidanandam,R., Hannon,G.J. and Carmell,M.A.
  TITLE     A germline-specific class of small RNAs binds mammalian Piwi
            proteins
  JOURNAL   Nature 442 (7099), 199-202 (2006)
   PUBMED   16751776
REFERENCE   5  (bases 1 to 8761)
  AUTHORS   Edgar,A.J. and Polak,J.M.
  TITLE     Cloning and tissue distribution of three murine alpha/beta
            hydrolase fold protein cDNAs
  JOURNAL   Biochem. Biophys. Res. Commun. 292 (3), 617-625 (2002)
   PUBMED   11922611
REFERENCE   6  (bases 1 to 8761)
  AUTHORS   Rapiejko,P.J., George,S.T. and Malbon,C.C.
  TITLE     Primary structure of a human protein which bears structural
            similarities to members of the rhodopsin/beta-adrenergic receptor
            family
  JOURNAL   Nucleic Acids Res. 16 (17), 8721 (1988)
   PUBMED   2843827
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DC397201.1, DB049736.1,
            BC090052.1, AC124068.6 and AI916724.1.
            On Jul 26, 2008 this sequence version replaced gi:93141022.
            
            Summary: This gene encodes a protein containing an alpha/beta
            hydrolase fold, which is a catalytic domain found in a very wide
            range of enzymes. The function of this protein has not been
            determined. Alternative splicing of this gene results in two
            transcript variants encoding the same protein. [provided by RefSeq,
            Jul 2008].
            
            Transcript Variant: This variant (2) lacks four consecutive exons
            within the 5' UTR, as compared to variant 1. Both variants encode
            the same protein.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF546700.1, AK223083.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025082 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-67                DC397201.1         1-67
            68-266              DB049736.1         1-199
            267-2126            BC090052.1         1-1860
            2127-8699           AC124068.6         29331-35903
            8700-8761           AI916724.1         1-62                c
FEATURES             Location/Qualifiers
     source          1..8761
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="15"
                     /map="15q26.1"
     gene            1..8761
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /note="abhydrolase domain containing 2"
                     /db_xref="GeneID:11057"
                     /db_xref="HGNC:18717"
                     /db_xref="MIM:612196"
     exon            1..414
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     variation       45
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:111908488"
     variation       49
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:113788281"
     variation       111
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:145772937"
     variation       179
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:28366027"
     variation       189
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:193284374"
     variation       265
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185529786"
     exon            415..514
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     variation       482
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186314767"
     misc_feature    503..505
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /note="upstream in-frame stop codon"
     exon            515..714
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     CDS             521..1798
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /note="lung alpha/beta hydrolase 2; alpha/beta hydrolase
                     domain containing protein 2; protein PHPS1-2"
                     /codon_start=1
                     /product="abhydrolase domain-containing protein 2"
                     /protein_id="NP_690888.1"
                     /db_xref="GI:23397661"
                     /db_xref="CCDS:CCDS10348.1"
                     /db_xref="GeneID:11057"
                     /db_xref="HGNC:18717"
                     /db_xref="MIM:612196"
                     /translation="
MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCPLLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEHCVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFGAMVNYIKKTYPLTQLVVVGFSLGGNIVCKYLGETQANQEKVLCCVSVCQGYSALRAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHVKKPQSLEDTDLSRLYTATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIPKSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKLQCSDTEQVEADLE
"
     misc_feature    548..610
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P08910.1);
                     transmembrane region"
     misc_feature    713..1720
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /note="Predicted hydrolase of the alpha/beta-hydrolase
                     fold [General function prediction only]; Region: COG0429"
                     /db_xref="CDD:30778"
     variation       533
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200083665"
     variation       557
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377224438"
     variation       601
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61753540"
     variation       607..608
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:35195117"
     variation       678
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140016091"
     variation       699
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:141982781"
     exon            715..890
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     variation       727
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144690140"
     variation       793
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:141659881"
     variation       799
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:142873328"
     variation       809
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377248748"
     variation       850
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:370107941"
     variation       854
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373748122"
     exon            891..1058
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     variation       994
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111436651"
     variation       995
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376591750"
     variation       1027
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200152203"
     variation       1031
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369834043"
     variation       1039
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139707395"
     variation       1048
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374535337"
     exon            1059..1242
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     variation       1066
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145289422"
     variation       1103
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147649579"
     variation       1127
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200218946"
     variation       1129
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:142298746"
     variation       1186
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:199669891"
     variation       1192
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201301214"
     variation       1202
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:375201895"
     variation       1217
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:150079355"
     variation       1219
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201540119"
     exon            1243..1335
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     variation       1264
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145464697"
     variation       1277
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371827987"
     variation       1278
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:17851730"
     variation       1283
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:77592008"
     variation       1330
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202074494"
     exon            1336..1446
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     variation       1340
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:116127688"
     variation       1343
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:184637482"
     variation       1353
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:78193744"
     variation       1361
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:189147436"
     variation       1367
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:368935537"
     variation       1375
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373053634"
     exon            1447..1516
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     variation       1456
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111401789"
     variation       1460
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374206617"
     variation       1476
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:371079523"
     exon            1517..1601
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     variation       1548
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142991295"
     variation       1552
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74029947"
     variation       1558
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139000256"
     variation       1593
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200904331"
     exon            1602..8735
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     variation       1602
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375506150"
     variation       1608
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201203844"
     variation       1615
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200267265"
     variation       1619
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:147106119"
     variation       1632
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199793936"
     variation       1648
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113179066"
     variation       1681
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149586205"
     variation       1682
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370942946"
     STS             1720..1954
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /standard_name="RH18085"
                     /db_xref="UniSTS:34600"
     variation       1720
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147741950"
     variation       1727
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374166259"
     variation       1746
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377476890"
     variation       1771
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370810519"
     variation       1780
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:8029350"
     variation       1787
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145208145"
     variation       1802
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201481330"
     variation       1806
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370285730"
     variation       1811
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3192916"
     variation       1821
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:374526376"
     variation       1830
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200625948"
     variation       1846
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371808513"
     variation       1859..1860
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="ct"
                     /db_xref="dbSNP:376216745"
     variation       1898
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:8029539"
     variation       1920
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:369238058"
     variation       1990
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146738558"
     variation       2038
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138896117"
     variation       2123
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:149364091"
     variation       2143..2144
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="aagg"
                     /db_xref="dbSNP:376443690"
     variation       2197
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:187870077"
     variation       2207
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111900920"
     variation       2236
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143721254"
     variation       2261
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:190153281"
     variation       2296
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148077432"
     variation       2403
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2283435"
     variation       2407
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:142748314"
     variation       2447
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:377666592"
     variation       2474
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373021353"
     variation       2508
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:146068503"
     variation       2520
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139971102"
     variation       2552
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79471145"
     variation       2557
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376244361"
     variation       2607
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:76670995"
     variation       2611
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:79475253"
     variation       2629
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:182416759"
     variation       2902
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141896541"
     variation       2944..2945
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="tg"
                     /db_xref="dbSNP:140683030"
     variation       2997
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:71762640"
     variation       3075
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:150761323"
     variation       3151
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186760778"
     STS             3156..3310
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /standard_name="STS-N68085"
                     /db_xref="UniSTS:39549"
     variation       3157
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79741476"
     variation       3169
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192692871"
     STS             3177..3309
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /standard_name="STS-R00701"
                     /db_xref="UniSTS:75967"
     variation       3210
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:185380641"
     variation       3213
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:188699413"
     variation       3216
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192840398"
     variation       3238
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369874910"
     variation       3289
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139149477"
     variation       3310
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149898040"
     variation       3311
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143961318"
     variation       3330
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111892818"
     variation       3362
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373394280"
     variation       3400
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184984623"
     variation       3439
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:188662948"
     variation       3517
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:8036512"
     variation       3528
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:8042607"
     variation       3579
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148647924"
     variation       3594
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144182259"
     variation       3609
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:147781570"
     variation       3613
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:8042649"
     variation       3665
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:142594327"
     variation       3725
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:28552510"
     variation       3760
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4932214"
     variation       3952
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144926917"
     variation       3964
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78806349"
     variation       4058
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:181150027"
     variation       4100
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370509147"
     variation       4156
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151292515"
     variation       4223
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183775907"
     variation       4273
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:140558079"
     variation       4499
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374074422"
     variation       4521
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368301313"
     variation       4650
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:77126743"
     variation       4666
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:74029950"
     variation       4701
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187959663"
     variation       4709
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:78907291"
     variation       4720
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:138199716"
     variation       4825..4826
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="tg"
                     /db_xref="dbSNP:147594593"
     variation       4855
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182419623"
     variation       4883
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141322282"
     variation       4981
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187034253"
     variation       5120
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:191965781"
     variation       5121
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144977703"
     variation       5132
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:733944"
     variation       5176
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115295866"
     variation       5230
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:181841856"
     variation       5257
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369572349"
     variation       5366
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2240588"
     variation       5394
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141802766"
     STS             5412..5933
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /standard_name="D15S1499"
                     /db_xref="UniSTS:474501"
     variation       5455
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186028547"
     variation       5519
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144635404"
     variation       5618
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2079594"
     variation       5671
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:200947140"
     variation       5672
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:5814358"
     variation       5672
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:75639692"
     variation       5677
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200878421"
     variation       5684
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:190402433"
     variation       5692
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148025652"
     variation       5740
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141728329"
     variation       5841
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182673335"
     variation       5923
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375867543"
     variation       5935
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140389483"
     variation       5960
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:186809584"
     variation       6000
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144313615"
     variation       6054
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147339559"
     variation       6077
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148308475"
     variation       6087
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:189690388"
     variation       6089..6090
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:369482115"
     variation       6146
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:149842217"
     variation       6176
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:729708"
     variation       6187
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:729707"
     variation       6199
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149014213"
     variation       6206
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:77577349"
     variation       6224
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:6496565"
     variation       6267
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184118580"
     variation       6286
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373232557"
     variation       6299
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:729706"
     variation       6480
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:76173219"
     variation       6481
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188675546"
     variation       6523..6524
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:199969725"
     variation       6524
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:369738130"
     variation       6580
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376627772"
     STS             6590..6716
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /standard_name="G27598"
                     /db_xref="UniSTS:10903"
     variation       6644
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:193233541"
     variation       6667
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185313657"
     variation       6812
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:9550"
     variation       6814
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:59684439"
     variation       6916
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:200031745"
     variation       6922
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151100720"
     variation       7037..7038
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:200841200"
     variation       7044
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:79118417"
     variation       7052
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:187349622"
     variation       7069
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:191685010"
     variation       7104..7105
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:375688536"
     variation       7114..7115
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:367862009"
     variation       7114
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79178069"
     variation       7148
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:7179900"
     variation       7159
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141277044"
     variation       7227
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183821867"
     STS             7239..7410
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /standard_name="D1S1425"
                     /db_xref="UniSTS:149621"
     variation       7276
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:75857481"
     variation       7302
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:188207112"
     variation       7307
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:75928307"
     variation       7309
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:79907874"
     variation       7334
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:58137913"
     variation       7429
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138798788"
     variation       7454..7455
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:36031072"
     variation       7458
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:112615188"
     variation       7494
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:180761098"
     variation       7504
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:113106926"
     variation       7620
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:6416547"
     variation       7641
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:140528761"
     variation       7692
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:79375214"
     variation       7748
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184374894"
     variation       7751
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044182"
     variation       7763
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1127674"
     variation       7772
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1127673"
     variation       7805
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1044178"
     variation       7825
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:114400366"
     variation       7906
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150412361"
     variation       7920
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11555210"
     variation       7946
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369580096"
     variation       8013..8014
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:16949953"
     variation       8016
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:16949949"
     variation       8044
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:375850322"
     variation       8059
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138076568"
     variation       8095
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149549561"
     variation       8116
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044170"
     variation       8124
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044166"
     variation       8126
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74029952"
     variation       8134
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:113748815"
     variation       8163
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1044162"
     variation       8163
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374827049"
     variation       8169
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044161"
     variation       8178
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1044159"
     variation       8198..8215
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="gggggcggcttgctcgct"
                     /db_xref="dbSNP:147885662"
     variation       8206..8223
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="cttgctcgctgggggcgg"
                     /db_xref="dbSNP:377089951"
     variation       8235
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:71405638"
     variation       8248..8249
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:34814193"
     variation       8261
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:369226856"
     variation       8266
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:56024153"
     variation       8285
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373636673"
     variation       8291
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190516934"
     variation       8455
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:143993225"
     variation       8470
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201495527"
     STS             8516..8649
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /standard_name="RH93467"
                     /db_xref="UniSTS:92076"
     variation       8655
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:112474293"
     variation       8657
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:79128075"
     variation       8669
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182354050"
ORIGIN      
agccctcctcccctttccccgcccactccgggctggccttatccagtagcgtctgggtccctggactaaagccgtcaaatgtaaccaattgctgaggagctctcccctaagaatcccgcctccactctgaggaacagcttcgctgatcaatggatcccctcctagacgcaatgagcgcgcggggcaagtggagaagcggctgaactgcccaatgaacaagcggtttccgtggttaggggcgtggcagaagcggtcgtcaggggcgtggcggcagttacttgggcggggccggtagcggcgggagctgcactggccaggggttccggctgtatatccatgagcgccgctggcagccggggagctgcaggaaccagactgggggcgagctgagcacctgtagtcaatcacacgcagcttttaggtttgtttgaataagagatctgacctgaccggcccaactgtacaactcttcaaggaaaattcgtatttgcagtgggaagaataagtaacattgatcaagatgaatgccatgctggagactcccgaactcccagccgtgtttgatggagtgaagctggctgcagtggctgctgtgctgtacgtgatcgtccggtgtttgaacctgaagagccccacagccccacctgacctctacttccaggactcggggctctcacgctttctgctcaagtcctgtcctcttctgaccaaagaatacattccaccgttgatctgggggaaaagtggacacatccagacagccttgtatgggaagatgggaagggtgaggtcgccacatccttatgggcaccggaagttcatcactatgtctgatggagccacttctacattcgacctcttcgagcccttggctgagcactgtgttggagatgatatcaccatggtcatctgccctggaattgccaatcacagcgagaagcaatacatccgcactttcgttgactacgcccagaaaaatggctatcggtgcgccgtgctgaaccacctgggtgccctgcccaacattgaattgacctcgccacgcatgttcacctatggctgcacgtgggaatttggagccatggtgaactacatcaagaagacatatcccctgacccagctggtcgtcgtgggcttcagcctgggtggtaacattgtgtgcaaatacttgggggagactcaggcaaaccaagagaaggtcctgtgctgcgtcagcgtgtgccaggggtacagtgcactgagggcccaggaaaccttcatgcaatgggatcagtgccggcggttctacaacttcctcatggctgacaacatgaagaagatcatcctctcgcacaggcaagctctttttggagaccatgttaagaaaccccagagcctggaagacacggacttgagccggctctacacagcaacatccctgatgcagattgatgacaatgtgatgaggaagtttcacggctataactccctgaaggaatactatgaggaagaaagttgcatgcggtacctgcacaggatttatgttcctctcatgctggttaatgcagctgacgatccgttggtgcatgaaagtcttctaaccattccaaaatctctttcagagaaacgagagaacgtcatgtttgtgctgcctctgcatgggggccacttgggcttctttgagggctctgtgctgttccccgagcccctgacatggatggataagctggtggtggagtacgccaacgccatttgccaatgggagcgtaacaagttgcagtgctctgacacggagcaggtggaggccgacctggagtgaggcctccggactctggcacgctccagcagccctcctctggaagctgcgtcccctcaccccctgtttcaggtctcccatctccctcagtgacctggatctgacctcacaccatcagcagggggcacccaccatgcacacctgtctcggagtaggcagctcttcctgggagctccaggctatttttgtgcttagttactggttttctccattgcattgttaggcatggtgacaagtgacagagttcttgccctctgtccagtttcagcatctggttgcttttaagccaagtacatctagtttccctattaaaaatgtgtctgaatagcgattttgctttgccaccaaaaggcttttccctgagaacagtgaaggatgtatgtcattttgtggtggttgtatgtgtccttacatagaccttaaaaagagctcacccttccaggccaatgctgaagacacagctccgcttgggagcctgagaacccaggcttcccaggccagagtgtggcttcttaaacggcaaaggaaattcctttgagtcacaagccaagttttcgccctgtctcctgagaccatttccctacgctttgctgctgctgagagttacgtgaggcacttgttaaaaattcagcctcccaggtccctcccctcggagaggctgattcactgggtctgggaaggagcctggggattttaatttttcacaagtgccccagatgattctcatcaccaagcaaattttggaaatgctgttcaacagcgcccttaaattggaaacatctttgcagctcgttttattgaaattcataatcaggggtgtcctctagctcccacggtctccagagcagcaaggccggctatggagctgccgtcgtgtgaccacagtgtgatgtctcagaagggctctgggtgggctgagcatctgggctgtgccctggctctgcttttcaccctggacaaagtcgctgtggacttcaatttcttcacctctaaaatgggggacttggaccaggtagattgctgagctcactaccaggttcaaagttcaatgacaaactcagtttactgaggtttgagagaacatccctccaggggagcctgggagctgctctcccagtctaagcatgtagatatcatcgtttgccttttgtgtgtgtgtgtcccttatttgataaaaagatgttttgagttgttttttttttaagcactcacttgtaattttagtttttaaacccaagtccctctaactttgcctttgataccaaacaattcaaaagttggatctgagtttggagaaagatatttccaacctaagtgggtattattttgaaaccagatttttaatttaatagcctatatttgtagtctgttggataggtgtttccaaagtgtgtcttctcaagtgaaaacgcaactctaggtttcaagtactccttttctccgatcctgtggtacttgaatatccaaaaaccctgcactttgaacaatcagctgttgctatctggaactaaacagaactatgagtaaaattgcctggatactttaaaaagatatttttcctccttcatctcctttgactccaggacagactggaatataagtagtgggtctgcatggatgtttcagggatcaaaggagccacctgggcgcctgagtgccaaccctcagggccacaggtgggtgtggtttgggcacgggtccaagtgactgtgacgggacccgtgggcatgggtccaggtctgtaacctgaagaagttgttttctgacaatcaccaaatcatccgaatgacatcaaaagcagcccttatctcagagactgagatttctgtggtctcaacttcgctttggtataatttctggcactcaccagcctctatcattatgactttccccccagtgtattatttctctaataggtttccttttcacgttcttttagcacagactggcactttaccctctcagtttggaagttagcccctctcctctgttacttttcccttcacccaactacagctgtgatctagaacattcatagtcatatttctgctactactaccttcatttatcaagactttttatgagaataggtaaaccaagcaataacttcctaggactgaatcaccaccccagaagagcgagaggctcctttcatatgcctgaggccacaccccttaacctgttctgacaaaatagtggctggcccatgtaccagctccattcagaaattcaggaagagaaaagacagccctgttgtcacacaaaccggtgtgggggagggtggagcctggtctgcacggcagtcctggtggcccctgtggaggacaggcagggctggcagcatagcctttgttgccacacaaccggaatttgctcccccaggactgtgggagccagtgtcccagctgaaatctttttagtgtgtggctctgaatggcactcacattccattttggctcacatgaaactaactgaagccctttgttcaagcttcaggctcttaggcatggaaatgagaatgtgactgtggctgtcttacaggaaaattcttgtttgtccctgaatgagagcacagaggcattgaattcacagagctgcaaacttgcctgataaatgagggagtggcagtttatagataggtcatcttttttccttcctccaggtgtccttgcctttcttcccaaagtcattcatttctgatgagtatatgaatccccctcttgctagtaaggttctatttgggctaaaacaaggctgaatttttaaagagtatttgaatatattttagaatcaaattgaggctataaattgcatcaatctggacaattccattgcaggaataatatgttaaaaaccaatggggagaagcacccacatctctcctgtagcactccgtgtctcataagcaatttgaagacacttacaagtaactgattccagtcaaattaggattaactgactcaaaaaatggtgtcaagtttctttaatgtttttatgttagaagtgagtttaacagacttgaagaaaactgttatcttttcctgctgtgagtttacacaaatgattccagagcagaatgaaagcagaaagctgttggttacaatattcttttaacctctctgcagcattttacacttactgggaaccttatgattcaccgtaagagtggaaatatacctgagttcgtgtcctaatggtctctaattcacattggatcgtgggcaaatcacctcacctctctgagcctgttccctcctcttagaccatctctaagaccacttcatctatttacacatcatttgcttgaacattgctgaacatctgcgtgaacttggcctctccagcccttgcaggtggaaacagctgtgtcaaggctcaaggctcacgctgaggggacttggagggagggggcttctgcattaagctttcctggtgaagacccttgatcttgtccaaagccctgtgtctttgactggcttctcttcagagtccccgttgtcatcgtaagacccttgctgtttggagggtggtcttgtgactgtggcagctgctggccgctggaatgaggagcctatctccatcctccagtgtgactcaggcagagcattgagaattcccagggcagaaatccttcctgctcaggctttcattctaaaactacagtcttcattaaagctgaactttctgggtagctgagcttatatgcccggcatctgaatgagagctctctttgtaactgtgtgacttgagatctagtttgccagctcctgggaaacaatacatgtgttcttgtttgtgtttgctcagcaagcagatgtctgagatgtaagaagcttttcttttcctgtggcattgattctgacttagagctgaagtaaaagatcactgaaacatcacgtcaagttgaagtcactcataggtctttgtcctttaggcaggacaggagagtcattaagaagcatttcactgtagcattctatcacaatatcatctggaattgttttctttgcccagaaagccttaacttgcctctagagaatccctggtattacaacgatattgcggcattagaattccaactcttctgctgtggaagtttgaagcgaagctgcagcaaaaccagagaatttcctcaagtggcctgtaggctccttgttatcttatgcccccacccctccctcaacaatatgagtgatccagaactggcccaaacacctcagctctggtccctttttgcccttcttggccttactctgttgttcaaagccactttggattgcttggatgcttcgaacagccatgaaaagtagcctgcctgtggcatttagaggccaagcaattgacagaaagggtttcttctacctctgttatctaagcagagggaagtaaacctctcaccgccccccacccctcactgcccccgattaccctagaattgctttcgccaaattgtagttgaagctaaggaaggggaatctggcccctgctgggagagggaactggaatgccacacaaggcaaggcctgcttccttccttcccctctgctgctgctgcctcggaacgctgcagcccaggcttcctcccacagtggcccttggaagcaggccgcagagtagacagctgctccttttggaagagtcagtcccctgtgttttctgaactgtttttcctagcatgtatgtgggtagagctttcatgcatctctagtaataataagctgaaattagttttttttttaattctccaatttaaaacttttaattaaaaagtaaattttaatgtcgaaaatgcaaacttggggagggcagaaagatcacacacaaggctgtcacttcatacttgcaggattgcacagcagccgggcagaggcgctcctcacttcccagatggggcggcgggcagcagagacgcacctcacttcctagacagtgcggcagccaggcacaggcacacctcacttcccagacagttgggcggccaggcaagcgctcctcacttcccagatggggcggctcccgggaagcggggctcctcacttcccagacagggtggccaggcagaggtgctcctcacttcccagaacaattctttatgaatttgataaaggactgaagtgcaactgaaagctgctagtgatgatctggtaatatacaatttgtccagtagccagtttgtttttattgtgttttctaaccataagagatcattaaaggcaaagcctgtatgacgctgtacacacacaaaaaaatggtcaccgcaggccatactaccaatgaaatggtaggtaaacaaatcttctggtcaagagaaaaaaaaaagaaatagcactctgcatgctttgctctacaagacgaatttccctagaaagaatccaatgaaggccgggcatagtggctcactcctgtaatcccagcactttggaggccgaggcgggtagatcacctgaggttaggagttcaagaccagcctggccaacatggtgaaaccccttctctactaaaaatgcaaaaattagctgggtgtggtggcgggcgcctgtaatcccagctactcgggaggctgaggtgggagaattgcttgaacccaggagacggaggttgcagtgagccgagatcacgcctctgcactccagcctgggcaacaagagtgagactccgtctccaaaaaaagaaaaggaatccagtgaaaatggctgcaattacaacaagaagtgaaggaagaagactggtgacatctctgaaggatgcagttgaggttgatccaggtttatccgaatatgctacctttctgagccttaaaccttcatctctcaggtgttgatttgcttctgatagcttcatcatttctccctgaagtcttttacactcttctgttagtttccttgtttcagtatcatgaagtgaagcactgtgtggttgtggcgtgggcccgtcttgcttagatgcattcagtgggacagctttgctgggttccatgtcattcaatttatcattttcattggggatctccatttggaatccattaattcatgaggttttgcctcattccacacagcttccatatctgaagtgtttagtggagcaaaaattgtaccataaacttgtgtttactcttttcattcggatcatagtcaaagggctgtagcattactgaaacagtcacagttgaccctgggtcaataattccactgttgggcctcacacagtaccggtgaggcacggtagtcttcactttgaaacacacttttctatccgatggatttcgcaatttaagatttgtagtgactacatctgtgaaggggcctttgaatttgaggtctatgggcgggtcgaggaccaggatctgctcgtgcttcgccgtggccccggaggcagacgccattggagagacagcgcagagcagggggcggcttgctcgctgggggcgggggacgatggcgagaggggagggggagcgagttcgcatctctccttttcctggttagactctgttcaaccacattcttatgttggcagatctgcttccagattgatttttagagcaccatcactttcacattcctgattctgattttgttttgttttgtttgggttttctgaaacttaaaatgctgccccgaaaatactatatttttgagtttgtgttctgaaagcctccgtgctgctggatctttggggggaaatacaggatccttcagcactgaggtgtttaagatttgcaactagcaatgcaattttttctaaatatggggatatttacctttattaagaaattatactaaacattgatgtccttgatcattttatgttctcatattacttttgattctactatgattgtgtggtggtgaacaaagatcattacaaacaaaaactgtaattttgttatatttgattcaatggaatttacctaaaaaataaagactaaaaatgtggtgtgaaaaaaaaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:11057 -> Molecular function: GO:0003674 [molecular_function] evidence: ND
            GeneID:11057 -> Molecular function: GO:0004091 [carboxylesterase activity] evidence: IEA
            GeneID:11057 -> Biological process: GO:0008150 [biological_process] evidence: ND
            GeneID:11057 -> Biological process: GO:0009611 [response to wounding] evidence: IEA
            GeneID:11057 -> Biological process: GO:0030336 [negative regulation of cell migration] evidence: IEA
            GeneID:11057 -> Cellular component: GO:0016021 [integral to membrane] evidence: NAS

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.