Home |
Help |
Advanced search
2024-04-20 18:32:40, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_152924 8761 bp mRNA linear PRI 15-JUN-2013
DEFINITION Homo sapiens abhydrolase domain containing 2 (ABHD2), transcript
variant 2, mRNA.
ACCESSION NM_152924
VERSION NM_152924.4 GI:194473690
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 8761)
AUTHORS Comuzzie,A.G., Cole,S.A., Laston,S.L., Voruganti,V.S., Haack,K.,
Gibbs,R.A. and Butte,N.F.
TITLE Novel genetic loci identified for the pathophysiology of childhood
obesity in the Hispanic population
JOURNAL PLoS ONE 7 (12), E51954 (2012)
PUBMED 23251661
REFERENCE 2 (bases 1 to 8761)
AUTHORS Giambra,V., Cianci,R., Lolli,S., Mattioli,C., Tampella,G.,
Cattalini,M., Kilic,S.S., Pandolfi,F., Plebani,A. and Frezza,D.
TITLE Allele *1 of HS1.2 enhancer associates with selective IgA
deficiency and IgM concentration
JOURNAL J. Immunol. 183 (12), 8280-8285 (2009)
PUBMED 20007591
REMARK GeneRIF: Patients with selective immunoglobulin (Ig)A deficiency
have a highly significant increase of homozygousity of HS1.2 allele
*1, with an increase of 2.6-fold; the HS1.2 polymorphism influences
Ig seric production, but not IgG switch.
REFERENCE 3 (bases 1 to 8761)
AUTHORS Miyata,K., Nakayama,M., Mizuta,S., Hokimoto,S., Sugamura,K.,
Oshima,S., Oike,Y., Sugiyama,S., Ogawa,H. and Yamamura,K.
TITLE Elevated mature macrophage expression of human ABHD2 gene in
vulnerable plaque
JOURNAL Biochem. Biophys. Res. Commun. 365 (2), 207-213 (2008)
PUBMED 17980156
REMARK GeneRIF: Our results showed that the ABHD2 was expressed in
atherosclerotic lesions, and that the ABHD2 expression was
significantly higher in the patients with UA than with SA.
REFERENCE 4 (bases 1 to 8761)
AUTHORS Girard,A., Sachidanandam,R., Hannon,G.J. and Carmell,M.A.
TITLE A germline-specific class of small RNAs binds mammalian Piwi
proteins
JOURNAL Nature 442 (7099), 199-202 (2006)
PUBMED 16751776
REFERENCE 5 (bases 1 to 8761)
AUTHORS Edgar,A.J. and Polak,J.M.
TITLE Cloning and tissue distribution of three murine alpha/beta
hydrolase fold protein cDNAs
JOURNAL Biochem. Biophys. Res. Commun. 292 (3), 617-625 (2002)
PUBMED 11922611
REFERENCE 6 (bases 1 to 8761)
AUTHORS Rapiejko,P.J., George,S.T. and Malbon,C.C.
TITLE Primary structure of a human protein which bears structural
similarities to members of the rhodopsin/beta-adrenergic receptor
family
JOURNAL Nucleic Acids Res. 16 (17), 8721 (1988)
PUBMED 2843827
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DC397201.1, DB049736.1,
BC090052.1, AC124068.6 and AI916724.1.
On Jul 26, 2008 this sequence version replaced gi:93141022.
Summary: This gene encodes a protein containing an alpha/beta
hydrolase fold, which is a catalytic domain found in a very wide
range of enzymes. The function of this protein has not been
determined. Alternative splicing of this gene results in two
transcript variants encoding the same protein. [provided by RefSeq,
Jul 2008].
Transcript Variant: This variant (2) lacks four consecutive exons
within the 5' UTR, as compared to variant 1. Both variants encode
the same protein.
Sequence Note: The RefSeq transcript and protein were derived from
genomic sequence to make the sequence consistent with the reference
genome assembly. The genomic coordinates used for the transcript
record were based on alignments.
##Evidence-Data-START##
Transcript exon combination :: AF546700.1, AK223083.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-67 DC397201.1 1-67
68-266 DB049736.1 1-199
267-2126 BC090052.1 1-1860
2127-8699 AC124068.6 29331-35903
8700-8761 AI916724.1 1-62 c
FEATURES Location/Qualifiers
source 1..8761
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="15"
/map="15q26.1"
gene 1..8761
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/note="abhydrolase domain containing 2"
/db_xref="GeneID:11057"
/db_xref="HGNC:18717"
/db_xref="MIM:612196"
exon 1..414
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/inference="alignment:Splign:1.39.8"
variation 45
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="t"
/db_xref="dbSNP:111908488"
variation 49
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="g"
/replace="t"
/db_xref="dbSNP:113788281"
variation 111
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="g"
/replace="t"
/db_xref="dbSNP:145772937"
variation 179
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:28366027"
variation 189
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:193284374"
variation 265
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:185529786"
exon 415..514
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/inference="alignment:Splign:1.39.8"
variation 482
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:186314767"
misc_feature 503..505
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/note="upstream in-frame stop codon"
exon 515..714
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/inference="alignment:Splign:1.39.8"
CDS 521..1798
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/note="lung alpha/beta hydrolase 2; alpha/beta hydrolase
domain containing protein 2; protein PHPS1-2"
/codon_start=1
/product="abhydrolase domain-containing protein 2"
/protein_id="NP_690888.1"
/db_xref="GI:23397661"
/db_xref="CCDS:CCDS10348.1"
/db_xref="GeneID:11057"
/db_xref="HGNC:18717"
/db_xref="MIM:612196"
/translation="
MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCPLLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEHCVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFGAMVNYIKKTYPLTQLVVVGFSLGGNIVCKYLGETQANQEKVLCCVSVCQGYSALRAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHVKKPQSLEDTDLSRLYTATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIPKSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKLQCSDTEQVEADLE
"
misc_feature 548..610
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P08910.1);
transmembrane region"
misc_feature 713..1720
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/note="Predicted hydrolase of the alpha/beta-hydrolase
fold [General function prediction only]; Region: COG0429"
/db_xref="CDD:30778"
variation 533
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:200083665"
variation 557
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:377224438"
variation 601
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:61753540"
variation 607..608
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace=""
/replace="t"
/db_xref="dbSNP:35195117"
variation 678
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:140016091"
variation 699
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:141982781"
exon 715..890
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/inference="alignment:Splign:1.39.8"
variation 727
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:144690140"
variation 793
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:141659881"
variation 799
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="t"
/db_xref="dbSNP:142873328"
variation 809
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:377248748"
variation 850
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="t"
/db_xref="dbSNP:370107941"
variation 854
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:373748122"
exon 891..1058
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/inference="alignment:Splign:1.39.8"
variation 994
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:111436651"
variation 995
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:376591750"
variation 1027
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:200152203"
variation 1031
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:369834043"
variation 1039
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:139707395"
variation 1048
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:374535337"
exon 1059..1242
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/inference="alignment:Splign:1.39.8"
variation 1066
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:145289422"
variation 1103
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:147649579"
variation 1127
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:200218946"
variation 1129
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="c"
/db_xref="dbSNP:142298746"
variation 1186
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="t"
/db_xref="dbSNP:199669891"
variation 1192
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:201301214"
variation 1202
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:375201895"
variation 1217
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:150079355"
variation 1219
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:201540119"
exon 1243..1335
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/inference="alignment:Splign:1.39.8"
variation 1264
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:145464697"
variation 1277
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:371827987"
variation 1278
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:17851730"
variation 1283
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="c"
/db_xref="dbSNP:77592008"
variation 1330
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:202074494"
exon 1336..1446
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/inference="alignment:Splign:1.39.8"
variation 1340
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:116127688"
variation 1343
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:184637482"
variation 1353
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="t"
/db_xref="dbSNP:78193744"
variation 1361
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:189147436"
variation 1367
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:368935537"
variation 1375
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:373053634"
exon 1447..1516
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/inference="alignment:Splign:1.39.8"
variation 1456
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:111401789"
variation 1460
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:374206617"
variation 1476
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="t"
/db_xref="dbSNP:371079523"
exon 1517..1601
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/inference="alignment:Splign:1.39.8"
variation 1548
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:142991295"
variation 1552
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:74029947"
variation 1558
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:139000256"
variation 1593
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:200904331"
exon 1602..8735
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/inference="alignment:Splign:1.39.8"
variation 1602
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:375506150"
variation 1608
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="g"
/replace="t"
/db_xref="dbSNP:201203844"
variation 1615
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:200267265"
variation 1619
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="c"
/db_xref="dbSNP:147106119"
variation 1632
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:199793936"
variation 1648
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:113179066"
variation 1681
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:149586205"
variation 1682
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:370942946"
STS 1720..1954
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/standard_name="RH18085"
/db_xref="UniSTS:34600"
variation 1720
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:147741950"
variation 1727
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:374166259"
variation 1746
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:377476890"
variation 1771
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:370810519"
variation 1780
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:8029350"
variation 1787
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:145208145"
variation 1802
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:201481330"
variation 1806
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:370285730"
variation 1811
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:3192916"
variation 1821
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="c"
/db_xref="dbSNP:374526376"
variation 1830
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:200625948"
variation 1846
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="g"
/replace="t"
/db_xref="dbSNP:371808513"
variation 1859..1860
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace=""
/replace="ct"
/db_xref="dbSNP:376216745"
variation 1898
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:8029539"
variation 1920
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="g"
/replace="t"
/db_xref="dbSNP:369238058"
variation 1990
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:146738558"
variation 2038
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:138896117"
variation 2123
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:149364091"
variation 2143..2144
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace=""
/replace="aagg"
/db_xref="dbSNP:376443690"
variation 2197
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:187870077"
variation 2207
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:111900920"
variation 2236
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:143721254"
variation 2261
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="g"
/replace="t"
/db_xref="dbSNP:190153281"
variation 2296
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:148077432"
variation 2403
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:2283435"
variation 2407
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:142748314"
variation 2447
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:377666592"
variation 2474
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:373021353"
variation 2508
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:146068503"
variation 2520
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:139971102"
variation 2552
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:79471145"
variation 2557
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:376244361"
variation 2607
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:76670995"
variation 2611
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:79475253"
variation 2629
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:182416759"
variation 2902
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:141896541"
variation 2944..2945
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace=""
/replace="tg"
/db_xref="dbSNP:140683030"
variation 2997
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace=""
/replace="t"
/db_xref="dbSNP:71762640"
variation 3075
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:150761323"
variation 3151
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:186760778"
STS 3156..3310
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/standard_name="STS-N68085"
/db_xref="UniSTS:39549"
variation 3157
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:79741476"
variation 3169
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:192692871"
STS 3177..3309
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/standard_name="STS-R00701"
/db_xref="UniSTS:75967"
variation 3210
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="c"
/db_xref="dbSNP:185380641"
variation 3213
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:188699413"
variation 3216
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:192840398"
variation 3238
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:369874910"
variation 3289
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:139149477"
variation 3310
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:149898040"
variation 3311
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:143961318"
variation 3330
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:111892818"
variation 3362
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:373394280"
variation 3400
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:184984623"
variation 3439
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:188662948"
variation 3517
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:8036512"
variation 3528
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="g"
/replace="t"
/db_xref="dbSNP:8042607"
variation 3579
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:148647924"
variation 3594
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:144182259"
variation 3609
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="t"
/db_xref="dbSNP:147781570"
variation 3613
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:8042649"
variation 3665
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="g"
/replace="t"
/db_xref="dbSNP:142594327"
variation 3725
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:28552510"
variation 3760
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:4932214"
variation 3952
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:144926917"
variation 3964
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:78806349"
variation 4058
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:181150027"
variation 4100
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:370509147"
variation 4156
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:151292515"
variation 4223
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:183775907"
variation 4273
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:140558079"
variation 4499
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="g"
/replace="t"
/db_xref="dbSNP:374074422"
variation 4521
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:368301313"
variation 4650
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:77126743"
variation 4666
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:74029950"
variation 4701
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:187959663"
variation 4709
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:78907291"
variation 4720
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="t"
/db_xref="dbSNP:138199716"
variation 4825..4826
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace=""
/replace="tg"
/db_xref="dbSNP:147594593"
variation 4855
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:182419623"
variation 4883
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:141322282"
variation 4981
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:187034253"
variation 5120
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:191965781"
variation 5121
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:144977703"
variation 5132
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:733944"
variation 5176
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:115295866"
variation 5230
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:181841856"
variation 5257
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:369572349"
variation 5366
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2240588"
variation 5394
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:141802766"
STS 5412..5933
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/standard_name="D15S1499"
/db_xref="UniSTS:474501"
variation 5455
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:186028547"
variation 5519
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:144635404"
variation 5618
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:2079594"
variation 5671
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace=""
/replace="t"
/db_xref="dbSNP:200947140"
variation 5672
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace=""
/replace="a"
/db_xref="dbSNP:5814358"
variation 5672
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="t"
/db_xref="dbSNP:75639692"
variation 5677
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="g"
/replace="t"
/db_xref="dbSNP:200878421"
variation 5684
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="c"
/db_xref="dbSNP:190402433"
variation 5692
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:148025652"
variation 5740
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:141728329"
variation 5841
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:182673335"
variation 5923
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:375867543"
variation 5935
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:140389483"
variation 5960
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:186809584"
variation 6000
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:144313615"
variation 6054
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:147339559"
variation 6077
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:148308475"
variation 6087
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:189690388"
variation 6089..6090
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace=""
/replace="c"
/db_xref="dbSNP:369482115"
variation 6146
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="g"
/replace="t"
/db_xref="dbSNP:149842217"
variation 6176
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:729708"
variation 6187
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:729707"
variation 6199
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:149014213"
variation 6206
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:77577349"
variation 6224
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="c"
/db_xref="dbSNP:6496565"
variation 6267
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:184118580"
variation 6286
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:373232557"
variation 6299
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:729706"
variation 6480
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:76173219"
variation 6481
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:188675546"
variation 6523..6524
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace=""
/replace="t"
/db_xref="dbSNP:199969725"
variation 6524
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace=""
/replace="t"
/db_xref="dbSNP:369738130"
variation 6580
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:376627772"
STS 6590..6716
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/standard_name="G27598"
/db_xref="UniSTS:10903"
variation 6644
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:193233541"
variation 6667
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:185313657"
variation 6812
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:9550"
variation 6814
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:59684439"
variation 6916
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace=""
/replace="c"
/db_xref="dbSNP:200031745"
variation 6922
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:151100720"
variation 7037..7038
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace=""
/replace="a"
/db_xref="dbSNP:200841200"
variation 7044
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="t"
/db_xref="dbSNP:79118417"
variation 7052
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:187349622"
variation 7069
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:191685010"
variation 7104..7105
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace=""
/replace="a"
/db_xref="dbSNP:375688536"
variation 7114..7115
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace=""
/replace="a"
/replace="aa"
/db_xref="dbSNP:367862009"
variation 7114
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:79178069"
variation 7148
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:7179900"
variation 7159
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:141277044"
variation 7227
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:183821867"
STS 7239..7410
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/standard_name="D1S1425"
/db_xref="UniSTS:149621"
variation 7276
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:75857481"
variation 7302
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:188207112"
variation 7307
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="t"
/db_xref="dbSNP:75928307"
variation 7309
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="t"
/db_xref="dbSNP:79907874"
variation 7334
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:58137913"
variation 7429
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:138798788"
variation 7454..7455
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace=""
/replace="c"
/db_xref="dbSNP:36031072"
variation 7458
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:112615188"
variation 7494
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:180761098"
variation 7504
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="g"
/replace="t"
/db_xref="dbSNP:113106926"
variation 7620
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="g"
/replace="t"
/db_xref="dbSNP:6416547"
variation 7641
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="g"
/replace="t"
/db_xref="dbSNP:140528761"
variation 7692
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="g"
/replace="t"
/db_xref="dbSNP:79375214"
variation 7748
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:184374894"
variation 7751
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1044182"
variation 7763
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1127674"
variation 7772
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1127673"
variation 7805
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1044178"
variation 7825
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="c"
/db_xref="dbSNP:114400366"
variation 7906
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:150412361"
variation 7920
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:11555210"
variation 7946
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:369580096"
variation 8013..8014
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:16949953"
variation 8016
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="c"
/db_xref="dbSNP:16949949"
variation 8044
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="c"
/db_xref="dbSNP:375850322"
variation 8059
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:138076568"
variation 8095
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:149549561"
variation 8116
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1044170"
variation 8124
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1044166"
variation 8126
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:74029952"
variation 8134
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="c"
/db_xref="dbSNP:113748815"
variation 8163
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1044162"
variation 8163
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:374827049"
variation 8169
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1044161"
variation 8178
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1044159"
variation 8198..8215
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace=""
/replace="gggggcggcttgctcgct"
/db_xref="dbSNP:147885662"
variation 8206..8223
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace=""
/replace="cttgctcgctgggggcgg"
/db_xref="dbSNP:377089951"
variation 8235
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:71405638"
variation 8248..8249
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace=""
/replace="a"
/db_xref="dbSNP:34814193"
variation 8261
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="g"
/replace="t"
/db_xref="dbSNP:369226856"
variation 8266
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:56024153"
variation 8285
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="t"
/db_xref="dbSNP:373636673"
variation 8291
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:190516934"
variation 8455
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="g"
/replace="t"
/db_xref="dbSNP:143993225"
variation 8470
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="g"
/replace="t"
/db_xref="dbSNP:201495527"
STS 8516..8649
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/standard_name="RH93467"
/db_xref="UniSTS:92076"
variation 8655
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="c"
/replace="g"
/db_xref="dbSNP:112474293"
variation 8657
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="g"
/replace="t"
/db_xref="dbSNP:79128075"
variation 8669
/gene="ABHD2"
/gene_synonym="HS1-2; LABH2; PHPS1-2"
/replace="a"
/replace="g"
/db_xref="dbSNP:182354050"
ORIGIN
agccctcctcccctttccccgcccactccgggctggccttatccagtagcgtctgggtccctggactaaagccgtcaaatgtaaccaattgctgaggagctctcccctaagaatcccgcctccactctgaggaacagcttcgctgatcaatggatcccctcctagacgcaatgagcgcgcggggcaagtggagaagcggctgaactgcccaatgaacaagcggtttccgtggttaggggcgtggcagaagcggtcgtcaggggcgtggcggcagttacttgggcggggccggtagcggcgggagctgcactggccaggggttccggctgtatatccatgagcgccgctggcagccggggagctgcaggaaccagactgggggcgagctgagcacctgtagtcaatcacacgcagcttttaggtttgtttgaataagagatctgacctgaccggcccaactgtacaactcttcaaggaaaattcgtatttgcagtgggaagaataagtaacattgatcaagatgaatgccatgctggagactcccgaactcccagccgtgtttgatggagtgaagctggctgcagtggctgctgtgctgtacgtgatcgtccggtgtttgaacctgaagagccccacagccccacctgacctctacttccaggactcggggctctcacgctttctgctcaagtcctgtcctcttctgaccaaagaatacattccaccgttgatctgggggaaaagtggacacatccagacagccttgtatgggaagatgggaagggtgaggtcgccacatccttatgggcaccggaagttcatcactatgtctgatggagccacttctacattcgacctcttcgagcccttggctgagcactgtgttggagatgatatcaccatggtcatctgccctggaattgccaatcacagcgagaagcaatacatccgcactttcgttgactacgcccagaaaaatggctatcggtgcgccgtgctgaaccacctgggtgccctgcccaacattgaattgacctcgccacgcatgttcacctatggctgcacgtgggaatttggagccatggtgaactacatcaagaagacatatcccctgacccagctggtcgtcgtgggcttcagcctgggtggtaacattgtgtgcaaatacttgggggagactcaggcaaaccaagagaaggtcctgtgctgcgtcagcgtgtgccaggggtacagtgcactgagggcccaggaaaccttcatgcaatgggatcagtgccggcggttctacaacttcctcatggctgacaacatgaagaagatcatcctctcgcacaggcaagctctttttggagaccatgttaagaaaccccagagcctggaagacacggacttgagccggctctacacagcaacatccctgatgcagattgatgacaatgtgatgaggaagtttcacggctataactccctgaaggaatactatgaggaagaaagttgcatgcggtacctgcacaggatttatgttcctctcatgctggttaatgcagctgacgatccgttggtgcatgaaagtcttctaaccattccaaaatctctttcagagaaacgagagaacgtcatgtttgtgctgcctctgcatgggggccacttgggcttctttgagggctctgtgctgttccccgagcccctgacatggatggataagctggtggtggagtacgccaacgccatttgccaatgggagcgtaacaagttgcagtgctctgacacggagcaggtggaggccgacctggagtgaggcctccggactctggcacgctccagcagccctcctctggaagctgcgtcccctcaccccctgtttcaggtctcccatctccctcagtgacctggatctgacctcacaccatcagcagggggcacccaccatgcacacctgtctcggagtaggcagctcttcctgggagctccaggctatttttgtgcttagttactggttttctccattgcattgttaggcatggtgacaagtgacagagttcttgccctctgtccagtttcagcatctggttgcttttaagccaagtacatctagtttccctattaaaaatgtgtctgaatagcgattttgctttgccaccaaaaggcttttccctgagaacagtgaaggatgtatgtcattttgtggtggttgtatgtgtccttacatagaccttaaaaagagctcacccttccaggccaatgctgaagacacagctccgcttgggagcctgagaacccaggcttcccaggccagagtgtggcttcttaaacggcaaaggaaattcctttgagtcacaagccaagttttcgccctgtctcctgagaccatttccctacgctttgctgctgctgagagttacgtgaggcacttgttaaaaattcagcctcccaggtccctcccctcggagaggctgattcactgggtctgggaaggagcctggggattttaatttttcacaagtgccccagatgattctcatcaccaagcaaattttggaaatgctgttcaacagcgcccttaaattggaaacatctttgcagctcgttttattgaaattcataatcaggggtgtcctctagctcccacggtctccagagcagcaaggccggctatggagctgccgtcgtgtgaccacagtgtgatgtctcagaagggctctgggtgggctgagcatctgggctgtgccctggctctgcttttcaccctggacaaagtcgctgtggacttcaatttcttcacctctaaaatgggggacttggaccaggtagattgctgagctcactaccaggttcaaagttcaatgacaaactcagtttactgaggtttgagagaacatccctccaggggagcctgggagctgctctcccagtctaagcatgtagatatcatcgtttgccttttgtgtgtgtgtgtcccttatttgataaaaagatgttttgagttgttttttttttaagcactcacttgtaattttagtttttaaacccaagtccctctaactttgcctttgataccaaacaattcaaaagttggatctgagtttggagaaagatatttccaacctaagtgggtattattttgaaaccagatttttaatttaatagcctatatttgtagtctgttggataggtgtttccaaagtgtgtcttctcaagtgaaaacgcaactctaggtttcaagtactccttttctccgatcctgtggtacttgaatatccaaaaaccctgcactttgaacaatcagctgttgctatctggaactaaacagaactatgagtaaaattgcctggatactttaaaaagatatttttcctccttcatctcctttgactccaggacagactggaatataagtagtgggtctgcatggatgtttcagggatcaaaggagccacctgggcgcctgagtgccaaccctcagggccacaggtgggtgtggtttgggcacgggtccaagtgactgtgacgggacccgtgggcatgggtccaggtctgtaacctgaagaagttgttttctgacaatcaccaaatcatccgaatgacatcaaaagcagcccttatctcagagactgagatttctgtggtctcaacttcgctttggtataatttctggcactcaccagcctctatcattatgactttccccccagtgtattatttctctaataggtttccttttcacgttcttttagcacagactggcactttaccctctcagtttggaagttagcccctctcctctgttacttttcccttcacccaactacagctgtgatctagaacattcatagtcatatttctgctactactaccttcatttatcaagactttttatgagaataggtaaaccaagcaataacttcctaggactgaatcaccaccccagaagagcgagaggctcctttcatatgcctgaggccacaccccttaacctgttctgacaaaatagtggctggcccatgtaccagctccattcagaaattcaggaagagaaaagacagccctgttgtcacacaaaccggtgtgggggagggtggagcctggtctgcacggcagtcctggtggcccctgtggaggacaggcagggctggcagcatagcctttgttgccacacaaccggaatttgctcccccaggactgtgggagccagtgtcccagctgaaatctttttagtgtgtggctctgaatggcactcacattccattttggctcacatgaaactaactgaagccctttgttcaagcttcaggctcttaggcatggaaatgagaatgtgactgtggctgtcttacaggaaaattcttgtttgtccctgaatgagagcacagaggcattgaattcacagagctgcaaacttgcctgataaatgagggagtggcagtttatagataggtcatcttttttccttcctccaggtgtccttgcctttcttcccaaagtcattcatttctgatgagtatatgaatccccctcttgctagtaaggttctatttgggctaaaacaaggctgaatttttaaagagtatttgaatatattttagaatcaaattgaggctataaattgcatcaatctggacaattccattgcaggaataatatgttaaaaaccaatggggagaagcacccacatctctcctgtagcactccgtgtctcataagcaatttgaagacacttacaagtaactgattccagtcaaattaggattaactgactcaaaaaatggtgtcaagtttctttaatgtttttatgttagaagtgagtttaacagacttgaagaaaactgttatcttttcctgctgtgagtttacacaaatgattccagagcagaatgaaagcagaaagctgttggttacaatattcttttaacctctctgcagcattttacacttactgggaaccttatgattcaccgtaagagtggaaatatacctgagttcgtgtcctaatggtctctaattcacattggatcgtgggcaaatcacctcacctctctgagcctgttccctcctcttagaccatctctaagaccacttcatctatttacacatcatttgcttgaacattgctgaacatctgcgtgaacttggcctctccagcccttgcaggtggaaacagctgtgtcaaggctcaaggctcacgctgaggggacttggagggagggggcttctgcattaagctttcctggtgaagacccttgatcttgtccaaagccctgtgtctttgactggcttctcttcagagtccccgttgtcatcgtaagacccttgctgtttggagggtggtcttgtgactgtggcagctgctggccgctggaatgaggagcctatctccatcctccagtgtgactcaggcagagcattgagaattcccagggcagaaatccttcctgctcaggctttcattctaaaactacagtcttcattaaagctgaactttctgggtagctgagcttatatgcccggcatctgaatgagagctctctttgtaactgtgtgacttgagatctagtttgccagctcctgggaaacaatacatgtgttcttgtttgtgtttgctcagcaagcagatgtctgagatgtaagaagcttttcttttcctgtggcattgattctgacttagagctgaagtaaaagatcactgaaacatcacgtcaagttgaagtcactcataggtctttgtcctttaggcaggacaggagagtcattaagaagcatttcactgtagcattctatcacaatatcatctggaattgttttctttgcccagaaagccttaacttgcctctagagaatccctggtattacaacgatattgcggcattagaattccaactcttctgctgtggaagtttgaagcgaagctgcagcaaaaccagagaatttcctcaagtggcctgtaggctccttgttatcttatgcccccacccctccctcaacaatatgagtgatccagaactggcccaaacacctcagctctggtccctttttgcccttcttggccttactctgttgttcaaagccactttggattgcttggatgcttcgaacagccatgaaaagtagcctgcctgtggcatttagaggccaagcaattgacagaaagggtttcttctacctctgttatctaagcagagggaagtaaacctctcaccgccccccacccctcactgcccccgattaccctagaattgctttcgccaaattgtagttgaagctaaggaaggggaatctggcccctgctgggagagggaactggaatgccacacaaggcaaggcctgcttccttccttcccctctgctgctgctgcctcggaacgctgcagcccaggcttcctcccacagtggcccttggaagcaggccgcagagtagacagctgctccttttggaagagtcagtcccctgtgttttctgaactgtttttcctagcatgtatgtgggtagagctttcatgcatctctagtaataataagctgaaattagttttttttttaattctccaatttaaaacttttaattaaaaagtaaattttaatgtcgaaaatgcaaacttggggagggcagaaagatcacacacaaggctgtcacttcatacttgcaggattgcacagcagccgggcagaggcgctcctcacttcccagatggggcggcgggcagcagagacgcacctcacttcctagacagtgcggcagccaggcacaggcacacctcacttcccagacagttgggcggccaggcaagcgctcctcacttcccagatggggcggctcccgggaagcggggctcctcacttcccagacagggtggccaggcagaggtgctcctcacttcccagaacaattctttatgaatttgataaaggactgaagtgcaactgaaagctgctagtgatgatctggtaatatacaatttgtccagtagccagtttgtttttattgtgttttctaaccataagagatcattaaaggcaaagcctgtatgacgctgtacacacacaaaaaaatggtcaccgcaggccatactaccaatgaaatggtaggtaaacaaatcttctggtcaagagaaaaaaaaaagaaatagcactctgcatgctttgctctacaagacgaatttccctagaaagaatccaatgaaggccgggcatagtggctcactcctgtaatcccagcactttggaggccgaggcgggtagatcacctgaggttaggagttcaagaccagcctggccaacatggtgaaaccccttctctactaaaaatgcaaaaattagctgggtgtggtggcgggcgcctgtaatcccagctactcgggaggctgaggtgggagaattgcttgaacccaggagacggaggttgcagtgagccgagatcacgcctctgcactccagcctgggcaacaagagtgagactccgtctccaaaaaaagaaaaggaatccagtgaaaatggctgcaattacaacaagaagtgaaggaagaagactggtgacatctctgaaggatgcagttgaggttgatccaggtttatccgaatatgctacctttctgagccttaaaccttcatctctcaggtgttgatttgcttctgatagcttcatcatttctccctgaagtcttttacactcttctgttagtttccttgtttcagtatcatgaagtgaagcactgtgtggttgtggcgtgggcccgtcttgcttagatgcattcagtgggacagctttgctgggttccatgtcattcaatttatcattttcattggggatctccatttggaatccattaattcatgaggttttgcctcattccacacagcttccatatctgaagtgtttagtggagcaaaaattgtaccataaacttgtgtttactcttttcattcggatcatagtcaaagggctgtagcattactgaaacagtcacagttgaccctgggtcaataattccactgttgggcctcacacagtaccggtgaggcacggtagtcttcactttgaaacacacttttctatccgatggatttcgcaatttaagatttgtagtgactacatctgtgaaggggcctttgaatttgaggtctatgggcgggtcgaggaccaggatctgctcgtgcttcgccgtggccccggaggcagacgccattggagagacagcgcagagcagggggcggcttgctcgctgggggcgggggacgatggcgagaggggagggggagcgagttcgcatctctccttttcctggttagactctgttcaaccacattcttatgttggcagatctgcttccagattgatttttagagcaccatcactttcacattcctgattctgattttgttttgttttgtttgggttttctgaaacttaaaatgctgccccgaaaatactatatttttgagtttgtgttctgaaagcctccgtgctgctggatctttggggggaaatacaggatccttcagcactgaggtgtttaagatttgcaactagcaatgcaattttttctaaatatggggatatttacctttattaagaaattatactaaacattgatgtccttgatcattttatgttctcatattacttttgattctactatgattgtgtggtggtgaacaaagatcattacaaacaaaaactgtaattttgttatatttgattcaatggaatttacctaaaaaataaagactaaaaatgtggtgtgaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:11057 -> Molecular function: GO:0003674 [molecular_function] evidence: ND
GeneID:11057 -> Molecular function: GO:0004091 [carboxylesterase activity] evidence: IEA
GeneID:11057 -> Biological process: GO:0008150 [biological_process] evidence: ND
GeneID:11057 -> Biological process: GO:0009611 [response to wounding] evidence: IEA
GeneID:11057 -> Biological process: GO:0030336 [negative regulation of cell migration] evidence: IEA
GeneID:11057 -> Cellular component: GO:0016021 [integral to membrane] evidence: NAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.