GGRNA Home | Help | Advanced search

2020-10-26 18:43:38, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_152409               4896 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens chromosome 5 open reading frame 24 (C5orf24),
            transcript variant 2, mRNA.
ACCESSION   NM_152409
VERSION     NM_152409.3  GI:207449709
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4896)
  AUTHORS   Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z.,
            Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S.,
            McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J.,
            Dunham,I., Hill,D.E. and Vidal,M.
  TITLE     hORFeome v3.1: a resource of human open reading frames representing
            over 10,000 human genes
  JOURNAL   Genomics 89 (3), 307-315 (2007)
   PUBMED   17207965
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BC053677.1 and AC006077.1.
            On Oct 1, 2008 this sequence version replaced gi:40255110.
            
            Transcript Variant: This variant (2) differs in the 5' UTR compared
            to variant 1. Variants 1 and 2 both encode the same protein.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data because no single transcript was available
            for the full length of the gene. The extent of this transcript is
            supported by transcript alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC053677.1, BU172095.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025095 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1840              BC053677.1         1-1840
            1841-4896           AC006077.1         23842-26897
FEATURES             Location/Qualifiers
     source          1..4896
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="5"
                     /map="5q31.1"
     gene            1..4896
                     /gene="C5orf24"
                     /note="chromosome 5 open reading frame 24"
                     /db_xref="GeneID:134553"
                     /db_xref="HGNC:26746"
                     /db_xref="HPRD:08226"
     exon            1..58
                     /gene="C5orf24"
                     /inference="alignment:Splign:1.39.8"
     variation       2
                     /gene="C5orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:182184432"
     misc_feature    44..46
                     /gene="C5orf24"
                     /note="upstream in-frame stop codon"
     exon            59..4896
                     /gene="C5orf24"
                     /inference="alignment:Splign:1.39.8"
     CDS             62..628
                     /gene="C5orf24"
                     /codon_start=1
                     /product="UPF0461 protein C5orf24"
                     /protein_id="NP_689622.2"
                     /db_xref="GI:40255111"
                     /db_xref="CCDS:CCDS4179.1"
                     /db_xref="GeneID:134553"
                     /db_xref="HGNC:26746"
                     /db_xref="HPRD:08226"
                     /translation="
MMHPVASSNPAFCGPGKPSCLNEDAMRAADQFDIYSSQQSKYSHTVNHKPMVCQRQDPLNETHLQTTSGRSIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKTSPGRPLGTTKAAGYKVSPGRPPGSIKALSRLADLGYGCGTAAFPYPMMHGRAVHGVEETSSEVKPPNE
"
     misc_feature    170..172
                     /gene="C5orf24"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q7Z6I8.1); phosphorylation site"
     misc_feature    170..172
                     /gene="C5orf24"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     variation       69
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182827108"
     variation       137
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144977700"
     variation       184
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368441862"
     variation       186
                     /gene="C5orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:76797142"
     variation       188
                     /gene="C5orf24"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:372418986"
     variation       198
                     /gene="C5orf24"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:373302777"
     variation       203
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:189210384"
     variation       250
                     /gene="C5orf24"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376967674"
     variation       268
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138898204"
     variation       320
                     /gene="C5orf24"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:142019018"
     variation       343
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146323904"
     variation       389
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368128995"
     variation       437
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148188988"
     variation       463
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141164760"
     variation       478
                     /gene="C5orf24"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:193092391"
     variation       491
                     /gene="C5orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:375925184"
     variation       509
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199887798"
     variation       560
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369059533"
     variation       578
                     /gene="C5orf24"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:150693644"
     variation       581
                     /gene="C5orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:139980444"
     variation       585
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150797739"
     variation       592
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145067433"
     variation       613
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:75692562"
     variation       621
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140427240"
     variation       670
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368013222"
     variation       675
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371433307"
     variation       681
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139222825"
     variation       683
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143589903"
     variation       691
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184484229"
     variation       907
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147194284"
     variation       925
                     /gene="C5orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:187459204"
     variation       953
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:191834107"
     variation       1088..1093
                     /gene="C5orf24"
                     /replace=""
                     /replace="gtaaca"
                     /db_xref="dbSNP:368150166"
     variation       1088
                     /gene="C5orf24"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:202016249"
     variation       1164
                     /gene="C5orf24"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:184054742"
     variation       1326
                     /gene="C5orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:376746765"
     variation       1380
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113314814"
     variation       1449
                     /gene="C5orf24"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:188596864"
     variation       1739
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112436387"
     variation       1802..1813
                     /gene="C5orf24"
                     /replace=""
                     /replace="aaataaataaat"
                     /db_xref="dbSNP:144902250"
     variation       1802..1805
                     /gene="C5orf24"
                     /replace=""
                     /replace="aaat"
                     /db_xref="dbSNP:202226698"
     variation       1813..1816
                     /gene="C5orf24"
                     /replace=""
                     /replace="taaa"
                     /db_xref="dbSNP:10552008"
     variation       1835
                     /gene="C5orf24"
                     /replace=""
                     /replace="ataa"
                     /db_xref="dbSNP:72322633"
     variation       1841
                     /gene="C5orf24"
                     /replace=""
                     /replace="taaa"
                     /db_xref="dbSNP:61626616"
     variation       1844
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:181710725"
     variation       1907
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185140929"
     variation       1941
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112492801"
     variation       1955
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190830022"
     variation       2004
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181935929"
     variation       2132
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144737830"
     variation       2159
                     /gene="C5orf24"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:186132693"
     variation       2514
                     /gene="C5orf24"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:78987868"
     misc_feature    2518..2592
                     /gene="C5orf24"
                     /note="GRAIL 2 excellent exon, frame 2"
     variation       2533
                     /gene="C5orf24"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373114001"
     variation       2610
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377231492"
     variation       2635
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115396590"
     variation       2658
                     /gene="C5orf24"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:145780106"
     variation       2794
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:114887018"
     prim_transcript join(2890..3299,3200..3477)
                     /gene="C5orf24"
                     /standard_name="af70g12"
                     /note="99% entity EST dbEST:AA625228"
     variation       2945
                     /gene="C5orf24"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:148502660"
     variation       2955
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:116661206"
     variation       3019
                     /gene="C5orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:189595352"
     variation       3181
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:180750598"
     variation       3209
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367598207"
     variation       3283
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:80346634"
     variation       3292
                     /gene="C5orf24"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:118050206"
     variation       3379
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374934904"
     variation       3433
                     /gene="C5orf24"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:185600585"
     variation       3566
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190060727"
     variation       3823
                     /gene="C5orf24"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:113157441"
     variation       3920
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151105359"
     STS             3955..4124
                     /gene="C5orf24"
                     /standard_name="SHGC-64770"
                     /db_xref="UniSTS:184206"
     variation       4023
                     /gene="C5orf24"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:15236"
     variation       4029
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112372759"
     variation       4084
                     /gene="C5orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:17695346"
     variation       4136
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145093735"
     variation       4240
                     /gene="C5orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:4418145"
     variation       4241
                     /gene="C5orf24"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371291842"
     variation       4303
                     /gene="C5orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:5028926"
     variation       4305
                     /gene="C5orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:5028927"
     variation       4308
                     /gene="C5orf24"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:5028928"
     variation       4319
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:62380022"
     variation       4321
                     /gene="C5orf24"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:140681325"
     variation       4324
                     /gene="C5orf24"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:5028929"
     STS             4618..4759
                     /gene="C5orf24"
                     /standard_name="A007F30"
                     /db_xref="UniSTS:63148"
     variation       4670
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11553310"
     STS             4674..4799
                     /gene="C5orf24"
                     /standard_name="RH47430"
                     /db_xref="UniSTS:24779"
     variation       4704
                     /gene="C5orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:3200480"
     variation       4708
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144649531"
     variation       4780
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35694512"
     variation       4795
                     /gene="C5orf24"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:11553311"
ORIGIN      
aagaaatggggtcagcaggagttccagcatctcagaattgtggtgaaaaccaatacaaaaaatgatgcatcctgttgccagcagtaatccagctttctgtgggcctggcaagccttcctgcctcaatgaagatgccatgagagctgctgatcagtttgacatatattcctcccagcaaagcaaatacagccacacagtcaaccacaaaccaatggtttgtcagaggcaagacccattaaatgaaacacacttgcagactacaagtggcagaagcatagaaataaaagatgaactaaagaaaaagaagaatctcaaccgatctggtaagcgtggccggccttcgggaaccaccaaatcagcaggataccggaccagcacaggcagacccctgggaaccaccaaagcagctggatttaagacaagtccaggcagacctttggggacaactaaagctgcgggatacaaagtcagcccaggcagacctccaggtagcattaaagctctatcccgtcttgccgatcttggttatggctgtggcactgctgcttttccttaccctatgatgcatggcagagcagttcatggggtagaggaaactagcagtgaagtcaaaccacccaatgagtgaatgaggcaggaaaagagggccaggtttagaaggaagattgtgaataatcccaaagcttcttggttttattttgatatacataattttatggcctgggctttccaaatttgttttcctgtttggtttttttcctgcttttgctcaaaaactgccatatgctgacagatgcactcagggcatgagcagcggcattgtatttgtacataggttcaagtgtaacacctaactaaatcatttttccttttcctttagagttatggtcatgtctcatgtttcattactactttggggctgttctaaatagatgctttatgtgataaacaactgaaaccattatacctattagtttgtgaagtaagcctacagtataataaagacactaacgtatttttaactgatggagcaaaaaagcaaactaatgaatcaggattacttgaggtaatggctgtgtgagtttttgtaacatttattttcacaagatgggacacatatttgtatgctttggcatttacatccacttcaaatgttaaaaaacttatttttaatgttttaggtttaagcagcttgtaatttattgatctacatggcattaattgatttaaccattatacctgaaataattcttcagtgtttgcctttgagcagtgataggttgtgtattttttaattgcctaagagcatatataccaaacactacaaacaattcatatttacagaaaatttaaactattttataaaaactgcacattacatttttggtgaaatatagtgcattctgaggatagcatatttcatataatagaaaaagaagcattctctaggtttgcatgtagctatagtcactatattttgcctttcatatagaaagttttaaagtattatgtttaaaaacatttattggctgggtgtggtggctcacacccagcactttgggaggccgaggcaggcggatcacttgaggtcagcagttcaagactagcctggccaacatggtgaaaccccatctctactaaaaatataaaaattagccaggcgtggtggcgggcgcctgtaatccaagctactggggaggctgaggcaggagaattgcttaaatccaggaggcggaggttgcagtgagccaagattgtgccactgcactccagcctgggtgacagagtaagactccgtctcaaataaataaataaataaataaataaataaataaataaataaaaccatttattgatgttgctcatttatttggaacgtttttagtttttctcagaaattgtcccattgcattagcacttactgtgttttcaggttgatatctaccaaaggacacaaattgaatggtagactgtaaaactggtataaacagaatgcagtttcccgaccatcagaacccaaatattaagaagcatataggaatccatctatgcatgaaacatgtaaaaaatatgttggttagtttaattaaaaatcttattgtgggtccagtgagaccatctcatccaaaagattttttttcccccaatgatgtttgctttagaagcaagatagaaaggaaaaaaagtattaggtagatatgtatagtagggacagagggaaatctttcttctttcctttctgaaagtaatacttcttgttacacattttatttattgagtttgttctaaataaaatattataaacttcagacttgaaaaaattccacttaactttaaagttacaatgtttgtatttgggattttaaatgcctttgagattaaaatgtagaattgcaggacccaaaaacttttaaaataattaaaattttaaaagagcacatgttgtgttttttgggcttgctattaatgcaaactctgattgcaaatggatgtcatgtttcataccttttttatcaggaaaaaagcagcaagccttcaggtgttccagtgatgcctgacacaattgagctggactttatgctgctctttacagtaagaggtgttgcattgtatgtggggactatgtgcactggcgtctaagacagtgacctcaacaatattagctttgcacaaaccatagagaacgatgttggatggttacataatcagttataacattctggcagctaaattgctacaagagctttttcttgcaaaagcttaaaatacaagatttttaataatttactcagaacagtataacttctgacacacacaaatgcttgcctctttattcatatgttcgttacctactctgtacatgtatctgtcatttagctgtttctcaagatgatgttcagcagttggctgcttagaaatctttttcaagccagtttctaaagacatttgtttaatgttctaccatagaataatgcacaccattgtcaaagatttgattattgtgttttatagtaagtccatttgacatttatttccctttcagtttattttccttccttattttgttatacatacccttccctttctcccctgcctttcgtacattcattcctcttcctctaccctccagcacatctacttactggtgctgtgctgtgtgtcagaagataaaacaggtgtattattgtataatgaattttgtatacatgtttatgaaatggtgagatcaactaaaggaggcatgttcataacagtgtttattatcagcagctatgtcccaggaaaaaaaaatgggaggggcaaatggctacagttgtaaatggataacatcatttagaaagccgaatttactgttcatctgagcggttacctggagtattatatctatgcactggtgagcatctcctgattccacttacttttctccctgtgaacagtttaccggtgccatgctgaagagaaagacatctaagtgataacatgaatgaagtcttaaaatttaaagtatttttactgctatataaactaaagactacattgtgcatattttgttaacactgtctcttgttatgataaacactgaaatagcatgttaaacagttgcctatactttaatataatcagttggggaaaactggccttttctcccccactgtatgattgtttcttgaaaggtaaattgctaattttatacagtgtaattctgttcttcacaaaataggtttcattattctatatttaaactgttggtcagaaaatgatctgcaattcaagtaagtctgcattacttttttctttaaaaagtactttaacatgccttatttattatattagcaaatgagctaataacagatgaaattttcattttttgacagatataaccttgcataagtagtatttagggtgattttgatactatctttagagttttgcattggatattaaaaaatatattggcacaatgtattggaagaaaatgagtagtatctggtttaatttttaatatttagggacattttaaaaaatcaatgttttaattagactaaaaattctttatattttttatttactttttaaagaaacatctgtcaaagtaatattgattccaaactgatgtttgtgtgaatttacatgtctattttcatgaactaagaatagagtttctttgagttgaggagaaaaaaatatatatgtgggtccatttattaggttaaagttgacccattcagtgtaaaaataaccatagtgtgtgagctaaagaaaaaaaaaagtaaatttctcctttatattctaagaagctttaaaagaacaattcaggggttattgataactgctactctgtcggtcattgtctctatatgcagtaaaattttatggtccctttataggaatataaagaattcaaaacagtttttcaaaagatttttttccttggacataaaaaattttgatgctattctatttttgtttttattacagcttaactgtatgctgttaaactctaggatgtatctgaatctttccttttttcccccctcctccaaatatataaatctgtgctctcacatgtaatgtatttaatttttggaaaatttaatgctatatagtaaatcaagtgtgtgatttaaagtaatcagatcactttgattcttttaagttttcagaatttcttttttccacaggtaattttggagaaaataattaccaattaactgataataagcacgctgtcctctgctgtaaaaagtctgaatagatactgtgtatgtttttatgtccatgaacttgagctactcgtgtgcaattatgtgtatgggaatggagtagtgttcatgatttgtatctacatcatcatatggatgtatatttattaataaagtcattactttaaaacca
//

Annotations:



by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.