GGRNA Home | Help | Advanced search

2024-04-26 09:31:55, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_148901               1003 bp    mRNA    linear   PRI 07-JUL-2013
DEFINITION  Homo sapiens tumor necrosis factor receptor superfamily, member 18
            (TNFRSF18), transcript variant 2, mRNA.
ACCESSION   NM_148901
VERSION     NM_148901.1  GI:23238193
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1003)
  AUTHORS   Arandi,N., Mirshafiey,A., Abolhassani,H., Jeddi-Tehrani,M.,
            Edalat,R., Sadeghi,B., Shaghaghi,M. and Aghamohammadi,A.
  TITLE     Frequency and expression of inhibitory markers of CD4(+) CD25(+)
            FOXP3(+) regulatory T cells in patients with common variable
            immunodeficiency
  JOURNAL   Scand. J. Immunol. 77 (5), 405-412 (2013)
   PUBMED   23432692
  REMARK    GeneRIF: Data indicate that the mRNAs of CTLA-4 and GITR genes were
            expressed at lower levels in CVID patients compared to control
            group.
REFERENCE   2  (bases 1 to 1003)
  AUTHORS   Pedroza-Gonzalez,A., Verhoef,C., Ijzermans,J.N.,
            Peppelenbosch,M.P., Kwekkeboom,J., Verheij,J., Janssen,H.L. and
            Sprengers,D.
  TITLE     Activated tumor-infiltrating CD4+ regulatory T cells restrain
            antitumor immunity in patients with primary or metastatic liver
            cancer
  JOURNAL   Hepatology 57 (1), 183-194 (2013)
   PUBMED   22911397
  REMARK    GeneRIF: Liver tumor Tregs up-regulate the expression of
            glucocorticoid-induced tumor necrosis factor receptor compared with
            Tregs in tumor-free liver tissue and blood.
REFERENCE   3  (bases 1 to 1003)
  AUTHORS   Jostins L, Ripke S, Weersma RK, Duerr RH, McGovern DP, Hui KY, Lee
            JC, Schumm LP, Sharma Y, Anderson CA, Essers J, Mitrovic M, Ning K,
            Cleynen I, Theatre E, Spain SL, Raychaudhuri S, Goyette P, Wei Z,
            Abraham C, Achkar JP, Ahmad T, Amininejad L, Ananthakrishnan AN,
            Andersen V, Andrews JM, Baidoo L, Balschun T, Bampton PA, Bitton A,
            Boucher G, Brand S, Buning C, Cohain A, Cichon S, D'Amato M, De
            Jong D, Devaney KL, Dubinsky M, Edwards C, Ellinghaus D, Ferguson
            LR, Franchimont D, Fransen K, Gearry R, Georges M, Gieger C, Glas
            J, Haritunians T, Hart A, Hawkey C, Hedl M, Hu X, Karlsen TH,
            Kupcinskas L, Kugathasan S, Latiano A, Laukens D, Lawrance IC, Lees
            CW, Louis E, Mahy G, Mansfield J, Morgan AR, Mowat C, Newman W,
            Palmieri O, Ponsioen CY, Potocnik U, Prescott NJ, Regueiro M,
            Rotter JI, Russell RK, Sanderson JD, Sans M, Satsangi J, Schreiber
            S, Simms LA, Sventoraityte J, Targan SR, Taylor KD, Tremelling M,
            Verspaget HW, De Vos M, Wijmenga C, Wilson DC, Winkelmann J, Xavier
            RJ, Zeissig S, Zhang B, Zhang CK, Zhao H, Silverberg MS, Annese V,
            Hakonarson H, Brant SR, Radford-Smith G, Mathew CG, Rioux JD,
            Schadt EE, Daly MJ, Franke A, Parkes M, Vermeire S, Barrett JC and
            Cho JH.
  CONSRTM   International IBD Genetics Consortium (IIBDGC)
  TITLE     Host-microbe interactions have shaped the genetic architecture of
            inflammatory bowel disease
  JOURNAL   Nature 491 (7422), 119-124 (2012)
   PUBMED   23128233
REFERENCE   4  (bases 1 to 1003)
  AUTHORS   von Rahden,B.H., Kircher,S., Landmann,D., Schlegel,N.,
            Lazariotou,M., Jurowich,C.F., Germer,C.T. and Grimm,M.
  TITLE     Glucocorticoid-induced tumour necrosis factor receptor expression:
            a potential molecular link between steroid intake and complicated
            diverticulitis?
  JOURNAL   Colorectal Dis 14 (10), 1276-1286 (2012)
   PUBMED   22309286
  REMARK    GeneRIF: Results suggest that GITR expression might indicate a
            molecular link between steroid use and complicated acute sigmoid
            diverticulitis. Increased MMP-9 expression by GITR signalling might
            explain morphological changes in the colonic wall in
            diverticulitis.
REFERENCE   5  (bases 1 to 1003)
  AUTHORS   Pan,Y., Li,X.P., Sun,J.F., Wang,L., Chen,Z., Li,X.M., Tao,J.H.,
            Qian,L. and Zhang,H.
  TITLE     [Effects of glucocorticoids on the expression of GTIR and apoptosis
            of the CD4(+)CD25(+)CD127(dim/-) T cells in patients with systemic
            lupus erythematosus]
  JOURNAL   Beijing Da Xue Xue Bao 44 (2), 215-220 (2012)
   PUBMED   22516990
  REMARK    GeneRIF: GITR is pathologically expressed on Treg cells in systemic
            lupus erythematosus.
REFERENCE   6  (bases 1 to 1003)
  AUTHORS   Shimizu,J., Yamazaki,S., Takahashi,T., Ishida,Y. and Sakaguchi,S.
  TITLE     Stimulation of CD25(+)CD4(+) regulatory T cells through GITR breaks
            immunological self-tolerance
  JOURNAL   Nat. Immunol. 3 (2), 135-142 (2002)
   PUBMED   11812990
REFERENCE   7  (bases 1 to 1003)
  AUTHORS   Nocentini,G., Ronchetti,S., Bartoli,A., Spinicelli,S., Delfino,D.,
            Brunetti,L., Migliorati,G. and Riccardi,C.
  TITLE     Identification of three novel mRNA splice variants of GITR
  JOURNAL   Cell Death Differ. 7 (4), 408-410 (2000)
   PUBMED   10836847
REFERENCE   8  (bases 1 to 1003)
  AUTHORS   Kwon,B., Yu,K.Y., Ni,J., Yu,G.L., Jang,I.K., Kim,Y.J., Xing,L.,
            Liu,D., Wang,S.X. and Kwon,B.S.
  TITLE     Identification of a novel activation-inducible protein of the tumor
            necrosis factor receptor superfamily and its ligand
  JOURNAL   J. Biol. Chem. 274 (10), 6056-6061 (1999)
   PUBMED   10037686
REFERENCE   9  (bases 1 to 1003)
  AUTHORS   Gurney,A.L., Marsters,S.A., Huang,R.M., Pitti,R.M., Mark,D.T.,
            Baldwin,D.T., Gray,A.M., Dowd,A.D., Brush,A.D., Heldens,A.D.,
            Schow,A.D., Goddard,A.D., Wood,W.I., Baker,K.P., Godowski,P.J. and
            Ashkenazi,A.
  TITLE     Identification of a new member of the tumor necrosis factor family
            and its receptor, a human ortholog of mouse GITR
  JOURNAL   Curr. Biol. 9 (4), 215-218 (1999)
   PUBMED   10074428
REFERENCE   10 (bases 1 to 1003)
  AUTHORS   Nocentini,G., Giunchi,L., Ronchetti,S., Krausz,L.T., Bartoli,A.,
            Moraca,R., Migliorati,G. and Riccardi,C.
  TITLE     A new member of the tumor necrosis factor/nerve growth factor
            receptor family inhibits T cell receptor-induced apoptosis
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 94 (12), 6216-6221 (1997)
   PUBMED   9177197
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AL162741.44 and AF241229.1.
            
            Summary: This gene encodes a member of the TNF-receptor
            superfamily. The encoded receptor has been shown to have increased
            expression upon T-cell activation, and it is thought to play a key
            role in dominant immunological self-tolerance maintained by
            CD25(+)CD4(+) regulatory T cells. Knockout studies in mice also
            suggest the role of this receptor is in the regulation of
            CD3-driven T-cell activation and programmed cell death. Three
            alternatively spliced transcript variants of this gene encoding
            distinct isoforms have been reported. [provided by RefSeq, Feb
            2011].
            
            Transcript Variant: This variant (2) encodes the longest protein
            (isoform 2).
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF241229.1 [ECO:0000332]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-325               AL162741.44        16497-16821         c
            326-1003            AF241229.1         188-865
FEATURES             Location/Qualifiers
     source          1..1003
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1p36.3"
     gene            1..1003
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
                     /note="tumor necrosis factor receptor superfamily, member
                     18"
                     /db_xref="GeneID:8784"
                     /db_xref="HGNC:11914"
                     /db_xref="MIM:603905"
     exon            1..325
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
                     /inference="alignment:Splign:1.39.8"
     STS             26..931
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
                     /db_xref="UniSTS:490342"
     misc_feature    127..129
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
                     /note="upstream in-frame stop codon"
     CDS             139..906
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
                     /note="isoform 2 precursor is encoded by transcript
                     variant 2; TNF receptor superfamily activation-inducible
                     protein; glucocorticoid-induced TNFR-related protein;
                     activation-inducible TNFR family receptor"
                     /codon_start=1
                     /product="tumor necrosis factor receptor superfamily
                     member 18 isoform 2 precursor"
                     /protein_id="NP_683699.1"
                     /db_xref="GI:23238194"
                     /db_xref="CCDS:CCDS9.1"
                     /db_xref="GeneID:8784"
                     /db_xref="HGNC:11914"
                     /db_xref="MIM:603905"
                     /translation="
MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCCWRCRRRPKTPEAASSPRKSGASDRQRRRGGWETCGCEPGRPPGPPTAASPSPGAPQAAGALRSALGRALLPWQQKWVQEGGSDQRPGPCSSAAAAGPCRRERETQSWPPSSLAGPDGVGS
"
     sig_peptide     139..213
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     mat_peptide     214..903
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
                     /product="tumor necrosis factor receptor superfamily
                     member 18 isoform 2"
     misc_feature    238..354
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Y5U5.1);
                     Region: TNFR-Cys 1"
     misc_feature    358..474
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Y5U5.1);
                     Region: TNFR-Cys 2"
     variation       266
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:11466676"
     exon            326..448
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
                     /inference="alignment:Splign:1.39.8"
     variation       328
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11466687"
     variation       330
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35586212"
     variation       385
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11466688"
     variation       399
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11466689"
     exon            449..536
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
                     /inference="alignment:Splign:1.39.8"
     variation       453
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11466691"
     exon            537..989
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
                     /inference="alignment:Splign:1.39.8"
     variation       661
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11466695"
     variation       675
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2298213"
     variation       962
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11466696"
     variation       964
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3819001"
     polyA_signal    970..975
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
     polyA_site      989
                     /gene="TNFRSF18"
                     /gene_synonym="AITR; CD357; GITR; GITR-D"
ORIGIN      
gtctacaccccctcctcacacgcacttcacctgggtcgggattctcaggtcatgaacggtcccagccacctccgggcagggcgggtgaggacggggacggggcgtgtccaactggctgtgggctcttgaaacccgagcatggcacagcacggggcgatgggcgcgtttcgggccctgtgcggcctggcgctgctgtgcgcgctcagcctgggtcagcgccccaccgggggtcccgggtgcggccctgggcgcctcctgcttgggacgggaacggacgcgcgctgctgccgggttcacacgacgcgctgctgccgcgattacccgggcgaggagtgctgttccgagtgggactgcatgtgtgtccagcctgaattccactgcggagacccttgctgcacgacctgccggcaccacccttgtcccccaggccagggggtacagtcccaggggaaattcagttttggcttccagtgtatcgactgtgcctcggggaccttctccgggggccacgaaggccactgcaaaccttggacagactgctgctggaggtgccgccgtcgaccgaagacgccagaagctgccagttccccgaggaagagcggggcgagcgatcggcagaggagaaggggcggctgggagacctgtgggtgtgagcctggccgtcctccggggccaccgaccgcagccagcccctccccaggagctccccaggccgcaggggctctgcgttctgctctgggccgggccctgctcccctggcagcagaagtgggtgcaggaaggtggcagtgaccagcgccctggaccatgcagttcggcggccgcggctgggccctgcaggagggagagagagacacagtcatggcccccttcctcccttgctggccctgatggggtggggtcttaggacgggaggctgtgtccgtgggtgtgcagtgcccagcacgggacccggctgcaggggaccttcaataaacacttgtccagtgaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:8784 -> Molecular function: GO:0005031 [tumor necrosis factor-activated receptor activity] evidence: TAS
            GeneID:8784 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
            GeneID:8784 -> Biological process: GO:0007165 [signal transduction] evidence: TAS
            GeneID:8784 -> Biological process: GO:0033209 [tumor necrosis factor-mediated signaling pathway] evidence: TAS
            GeneID:8784 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS
            GeneID:8784 -> Cellular component: GO:0005576 [extracellular region] evidence: IEA
            GeneID:8784 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: IEA
            GeneID:8784 -> Cellular component: GO:0009897 [external side of plasma membrane] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.