2024-04-26 09:31:55, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_148901 1003 bp mRNA linear PRI 07-JUL-2013 DEFINITION Homo sapiens tumor necrosis factor receptor superfamily, member 18 (TNFRSF18), transcript variant 2, mRNA. ACCESSION NM_148901 VERSION NM_148901.1 GI:23238193 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1003) AUTHORS Arandi,N., Mirshafiey,A., Abolhassani,H., Jeddi-Tehrani,M., Edalat,R., Sadeghi,B., Shaghaghi,M. and Aghamohammadi,A. TITLE Frequency and expression of inhibitory markers of CD4(+) CD25(+) FOXP3(+) regulatory T cells in patients with common variable immunodeficiency JOURNAL Scand. J. Immunol. 77 (5), 405-412 (2013) PUBMED 23432692 REMARK GeneRIF: Data indicate that the mRNAs of CTLA-4 and GITR genes were expressed at lower levels in CVID patients compared to control group. REFERENCE 2 (bases 1 to 1003) AUTHORS Pedroza-Gonzalez,A., Verhoef,C., Ijzermans,J.N., Peppelenbosch,M.P., Kwekkeboom,J., Verheij,J., Janssen,H.L. and Sprengers,D. TITLE Activated tumor-infiltrating CD4+ regulatory T cells restrain antitumor immunity in patients with primary or metastatic liver cancer JOURNAL Hepatology 57 (1), 183-194 (2013) PUBMED 22911397 REMARK GeneRIF: Liver tumor Tregs up-regulate the expression of glucocorticoid-induced tumor necrosis factor receptor compared with Tregs in tumor-free liver tissue and blood. REFERENCE 3 (bases 1 to 1003) AUTHORS Jostins L, Ripke S, Weersma RK, Duerr RH, McGovern DP, Hui KY, Lee JC, Schumm LP, Sharma Y, Anderson CA, Essers J, Mitrovic M, Ning K, Cleynen I, Theatre E, Spain SL, Raychaudhuri S, Goyette P, Wei Z, Abraham C, Achkar JP, Ahmad T, Amininejad L, Ananthakrishnan AN, Andersen V, Andrews JM, Baidoo L, Balschun T, Bampton PA, Bitton A, Boucher G, Brand S, Buning C, Cohain A, Cichon S, D'Amato M, De Jong D, Devaney KL, Dubinsky M, Edwards C, Ellinghaus D, Ferguson LR, Franchimont D, Fransen K, Gearry R, Georges M, Gieger C, Glas J, Haritunians T, Hart A, Hawkey C, Hedl M, Hu X, Karlsen TH, Kupcinskas L, Kugathasan S, Latiano A, Laukens D, Lawrance IC, Lees CW, Louis E, Mahy G, Mansfield J, Morgan AR, Mowat C, Newman W, Palmieri O, Ponsioen CY, Potocnik U, Prescott NJ, Regueiro M, Rotter JI, Russell RK, Sanderson JD, Sans M, Satsangi J, Schreiber S, Simms LA, Sventoraityte J, Targan SR, Taylor KD, Tremelling M, Verspaget HW, De Vos M, Wijmenga C, Wilson DC, Winkelmann J, Xavier RJ, Zeissig S, Zhang B, Zhang CK, Zhao H, Silverberg MS, Annese V, Hakonarson H, Brant SR, Radford-Smith G, Mathew CG, Rioux JD, Schadt EE, Daly MJ, Franke A, Parkes M, Vermeire S, Barrett JC and Cho JH. CONSRTM International IBD Genetics Consortium (IIBDGC) TITLE Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease JOURNAL Nature 491 (7422), 119-124 (2012) PUBMED 23128233 REFERENCE 4 (bases 1 to 1003) AUTHORS von Rahden,B.H., Kircher,S., Landmann,D., Schlegel,N., Lazariotou,M., Jurowich,C.F., Germer,C.T. and Grimm,M. TITLE Glucocorticoid-induced tumour necrosis factor receptor expression: a potential molecular link between steroid intake and complicated diverticulitis? JOURNAL Colorectal Dis 14 (10), 1276-1286 (2012) PUBMED 22309286 REMARK GeneRIF: Results suggest that GITR expression might indicate a molecular link between steroid use and complicated acute sigmoid diverticulitis. Increased MMP-9 expression by GITR signalling might explain morphological changes in the colonic wall in diverticulitis. REFERENCE 5 (bases 1 to 1003) AUTHORS Pan,Y., Li,X.P., Sun,J.F., Wang,L., Chen,Z., Li,X.M., Tao,J.H., Qian,L. and Zhang,H. TITLE [Effects of glucocorticoids on the expression of GTIR and apoptosis of the CD4(+)CD25(+)CD127(dim/-) T cells in patients with systemic lupus erythematosus] JOURNAL Beijing Da Xue Xue Bao 44 (2), 215-220 (2012) PUBMED 22516990 REMARK GeneRIF: GITR is pathologically expressed on Treg cells in systemic lupus erythematosus. REFERENCE 6 (bases 1 to 1003) AUTHORS Shimizu,J., Yamazaki,S., Takahashi,T., Ishida,Y. and Sakaguchi,S. TITLE Stimulation of CD25(+)CD4(+) regulatory T cells through GITR breaks immunological self-tolerance JOURNAL Nat. Immunol. 3 (2), 135-142 (2002) PUBMED 11812990 REFERENCE 7 (bases 1 to 1003) AUTHORS Nocentini,G., Ronchetti,S., Bartoli,A., Spinicelli,S., Delfino,D., Brunetti,L., Migliorati,G. and Riccardi,C. TITLE Identification of three novel mRNA splice variants of GITR JOURNAL Cell Death Differ. 7 (4), 408-410 (2000) PUBMED 10836847 REFERENCE 8 (bases 1 to 1003) AUTHORS Kwon,B., Yu,K.Y., Ni,J., Yu,G.L., Jang,I.K., Kim,Y.J., Xing,L., Liu,D., Wang,S.X. and Kwon,B.S. TITLE Identification of a novel activation-inducible protein of the tumor necrosis factor receptor superfamily and its ligand JOURNAL J. Biol. Chem. 274 (10), 6056-6061 (1999) PUBMED 10037686 REFERENCE 9 (bases 1 to 1003) AUTHORS Gurney,A.L., Marsters,S.A., Huang,R.M., Pitti,R.M., Mark,D.T., Baldwin,D.T., Gray,A.M., Dowd,A.D., Brush,A.D., Heldens,A.D., Schow,A.D., Goddard,A.D., Wood,W.I., Baker,K.P., Godowski,P.J. and Ashkenazi,A. TITLE Identification of a new member of the tumor necrosis factor family and its receptor, a human ortholog of mouse GITR JOURNAL Curr. Biol. 9 (4), 215-218 (1999) PUBMED 10074428 REFERENCE 10 (bases 1 to 1003) AUTHORS Nocentini,G., Giunchi,L., Ronchetti,S., Krausz,L.T., Bartoli,A., Moraca,R., Migliorati,G. and Riccardi,C. TITLE A new member of the tumor necrosis factor/nerve growth factor receptor family inhibits T cell receptor-induced apoptosis JOURNAL Proc. Natl. Acad. Sci. U.S.A. 94 (12), 6216-6221 (1997) PUBMED 9177197 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL162741.44 and AF241229.1. Summary: This gene encodes a member of the TNF-receptor superfamily. The encoded receptor has been shown to have increased expression upon T-cell activation, and it is thought to play a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells. Knockout studies in mice also suggest the role of this receptor is in the regulation of CD3-driven T-cell activation and programmed cell death. Three alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Feb 2011]. Transcript Variant: This variant (2) encodes the longest protein (isoform 2). Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AF241229.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-325 AL162741.44 16497-16821 c 326-1003 AF241229.1 188-865 FEATURES Location/Qualifiers source 1..1003 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="1" /map="1p36.3" gene 1..1003 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" /note="tumor necrosis factor receptor superfamily, member 18" /db_xref="GeneID:8784" /db_xref="HGNC:11914" /db_xref="MIM:603905" exon 1..325 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" /inference="alignment:Splign:1.39.8" STS 26..931 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" /db_xref="UniSTS:490342" misc_feature 127..129 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" /note="upstream in-frame stop codon" CDS 139..906 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" /note="isoform 2 precursor is encoded by transcript variant 2; TNF receptor superfamily activation-inducible protein; glucocorticoid-induced TNFR-related protein; activation-inducible TNFR family receptor" /codon_start=1 /product="tumor necrosis factor receptor superfamily member 18 isoform 2 precursor" /protein_id="NP_683699.1" /db_xref="GI:23238194" /db_xref="CCDS:CCDS9.1" /db_xref="GeneID:8784" /db_xref="HGNC:11914" /db_xref="MIM:603905" /translation="
MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCCWRCRRRPKTPEAASSPRKSGASDRQRRRGGWETCGCEPGRPPGPPTAASPSPGAPQAAGALRSALGRALLPWQQKWVQEGGSDQRPGPCSSAAAAGPCRRERETQSWPPSSLAGPDGVGS
" sig_peptide 139..213 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" /inference="COORDINATES: ab initio prediction:SignalP:4.0" mat_peptide 214..903 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" /product="tumor necrosis factor receptor superfamily member 18 isoform 2" misc_feature 238..354 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q9Y5U5.1); Region: TNFR-Cys 1" misc_feature 358..474 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q9Y5U5.1); Region: TNFR-Cys 2" variation 266 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" /replace="c" /replace="g" /db_xref="dbSNP:11466676" exon 326..448 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" /inference="alignment:Splign:1.39.8" variation 328 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" /replace="a" /replace="g" /db_xref="dbSNP:11466687" variation 330 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" /replace="a" /replace="g" /db_xref="dbSNP:35586212" variation 385 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" /replace="a" /replace="g" /db_xref="dbSNP:11466688" variation 399 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" /replace="a" /replace="g" /db_xref="dbSNP:11466689" exon 449..536 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" /inference="alignment:Splign:1.39.8" variation 453 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" /replace="a" /replace="g" /db_xref="dbSNP:11466691" exon 537..989 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" /inference="alignment:Splign:1.39.8" variation 661 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" /replace="c" /replace="t" /db_xref="dbSNP:11466695" variation 675 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" /replace="a" /replace="g" /db_xref="dbSNP:2298213" variation 962 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" /replace="a" /replace="g" /db_xref="dbSNP:11466696" variation 964 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" /replace="a" /replace="g" /db_xref="dbSNP:3819001" polyA_signal 970..975 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" polyA_site 989 /gene="TNFRSF18" /gene_synonym="AITR; CD357; GITR; GITR-D" ORIGIN
gtctacaccccctcctcacacgcacttcacctgggtcgggattctcaggtcatgaacggtcccagccacctccgggcagggcgggtgaggacggggacggggcgtgtccaactggctgtgggctcttgaaacccgagcatggcacagcacggggcgatgggcgcgtttcgggccctgtgcggcctggcgctgctgtgcgcgctcagcctgggtcagcgccccaccgggggtcccgggtgcggccctgggcgcctcctgcttgggacgggaacggacgcgcgctgctgccgggttcacacgacgcgctgctgccgcgattacccgggcgaggagtgctgttccgagtgggactgcatgtgtgtccagcctgaattccactgcggagacccttgctgcacgacctgccggcaccacccttgtcccccaggccagggggtacagtcccaggggaaattcagttttggcttccagtgtatcgactgtgcctcggggaccttctccgggggccacgaaggccactgcaaaccttggacagactgctgctggaggtgccgccgtcgaccgaagacgccagaagctgccagttccccgaggaagagcggggcgagcgatcggcagaggagaaggggcggctgggagacctgtgggtgtgagcctggccgtcctccggggccaccgaccgcagccagcccctccccaggagctccccaggccgcaggggctctgcgttctgctctgggccgggccctgctcccctggcagcagaagtgggtgcaggaaggtggcagtgaccagcgccctggaccatgcagttcggcggccgcggctgggccctgcaggagggagagagagacacagtcatggcccccttcctcccttgctggccctgatggggtggggtcttaggacgggaggctgtgtccgtgggtgtgcagtgcccagcacgggacccggctgcaggggaccttcaataaacacttgtccagtgaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:8784 -> Molecular function: GO:0005031 [tumor necrosis factor-activated receptor activity] evidence: TAS GeneID:8784 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA GeneID:8784 -> Biological process: GO:0007165 [signal transduction] evidence: TAS GeneID:8784 -> Biological process: GO:0033209 [tumor necrosis factor-mediated signaling pathway] evidence: TAS GeneID:8784 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS GeneID:8784 -> Cellular component: GO:0005576 [extracellular region] evidence: IEA GeneID:8784 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: IEA GeneID:8784 -> Cellular component: GO:0009897 [external side of plasma membrane] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.