LOCUS       NM_145805               1836 bp    mRNA    linear   PRI 07-JUL-2013
DEFINITION  Homo sapiens ISL LIM homeobox 2 (ISL2), mRNA.
ACCESSION   NM_145805
VERSION     NM_145805.1  GI:21956640
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1836)
  AUTHORS   Oshikawa,M., Tsutsui,C., Ikegami,T., Fuchida,Y., Matsubara,M.,
            Toyama,S., Usami,R., Ohtoko,K. and Kato,S.
  TITLE     Full-length transcriptome analysis of human retina-derived cell
            lines ARPE-19 and Y79 using the vector-capping method
  JOURNAL   Invest. Ophthalmol. Vis. Sci. 52 (9), 6662-6670 (2011)
   PUBMED   21697133
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1836)
  AUTHORS   Tsigankov,D. and Koulakov,A.A.
  TITLE     Sperry versus Hebb: topographic mapping in Isl2/EphA3 mutant mice
  JOURNAL   BMC Neurosci 11, 155 (2010)
   PUBMED   21190559
  REMARK    GeneRIF: Experiments in Isl2/EphA3 knock-in mice test the
            interactions between effects of molecular labels and correlated
            activity during the development of neural connectivity.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1836)
  AUTHORS   Li,Y., Zhang,Y., He,B., Wang,Y., Yuan,Z., Yuan,W., Liao,P.,
            Deng,Y., Xiao,J., Zhu,C., Wang,Y., Wu,X. and Liu,M.
  TITLE     Cloning and expression of a novel human gene, Isl-2, encoded a
            LIM-homeodomain protein
  JOURNAL   Mol. Biol. Rep. 34 (1), 19-26 (2007)
   PUBMED   17091338
  REMARK    GeneRIF: The broad expression of Isl-2 gene in tissues during
            embryogenesis and adult development suggests that it may be
            involved in both differentiation and maintenance of these tissues
            and might play an important role.
REFERENCE   4  (bases 1 to 1836)
  AUTHORS   Beausoleil,S.A., Jedrychowski,M., Schwartz,D., Elias,J.E.,
            Villen,J., Li,J., Cohn,M.A., Cantley,L.C. and Gygi,S.P.
  TITLE     Large-scale characterization of HeLa cell nuclear phosphoproteins
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135 (2004)
   PUBMED   15302935
REFERENCE   5  (bases 1 to 1836)
  AUTHORS   Jurata,L.W., Pfaff,S.L. and Gill,G.N.
  TITLE     The nuclear LIM domain interactor NLI mediates homo- and
            heterodimerization of LIM domain transcription factors
  JOURNAL   J. Biol. Chem. 273 (6), 3152-3157 (1998)
   PUBMED   9452425
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC012136.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC012136.1, BC011967.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1836
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="15"
                     /map="15q23"
     gene            1..1836
                     /gene="ISL2"
                     /note="ISL LIM homeobox 2"
                     /db_xref="GeneID:64843"
                     /db_xref="HGNC:18524"
                     /db_xref="HPRD:11053"
                     /db_xref="MIM:609481"
     exon            1..136
                     /gene="ISL2"
                     /inference="alignment:Splign:1.39.8"
     variation       22
                     /gene="ISL2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2203821"
     CDS             79..1158
                     /gene="ISL2"
                     /note="ISL2 transcription factor, LIM/homeodomain,
                     (islet-2)"
                     /codon_start=1
                     /product="insulin gene enhancer protein ISL-2"
                     /protein_id="NP_665804.1"
                     /db_xref="GI:21956641"
                     /db_xref="CCDS:CCDS10290.1"
                     /db_xref="GeneID:64843"
                     /db_xref="HGNC:18524"
                     /db_xref="HPRD:11053"
                     /db_xref="MIM:609481"
                     /translation="

MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQYLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVCSRQLLPGDEFSLREHELLCRADHGLLLERAAAGSPRSPGPLPGARGLHLPDAGSGRQPALRPHVHKQTEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPPWKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET

"
     misc_feature    157..321
                     /gene="ISL2"
                     /note="The first LIM domain of Isl, a member of LHX
                     protein family; Region: LIM1_Isl; cd09366"
                     /db_xref="CDD:188752"
     misc_feature    order(157..159,166..168,223..225,232..234,241..243,
                     250..252,307..309,316..318)
                     /gene="ISL2"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188752"
     misc_feature    343..507
                     /gene="ISL2"
                     /note="The second LIM domain of Isl2; Region: LIM2_Isl2;
                     cd09471"
                     /db_xref="CDD:188855"
     misc_feature    order(343..345,352..354,409..411,418..420,427..429,
                     436..438,493..495,502..504)
                     /gene="ISL2"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188855"
     misc_feature    547..549
                     /gene="ISL2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /citation=[4]
     misc_feature    655..828
                     /gene="ISL2"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(655..666,670..672,721..723,739..741,778..780,
                     784..789,796..801,805..813,817..822)
                     /gene="ISL2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(658..660,667..669,787..789,796..801,808..810)
                     /gene="ISL2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     misc_feature    892..981
                     /gene="ISL2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q96A47.1);
                     Region: LIM-binding domain (LID) (By similarity)"
     misc_feature    913..915
                     /gene="ISL2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q96A47.1); phosphorylation site"
     variation       104
                     /gene="ISL2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148510226"
     variation       123
                     /gene="ISL2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:142844685"
     exon            137..326
                     /gene="ISL2"
                     /inference="alignment:Splign:1.39.8"
     variation       199
                     /gene="ISL2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:202060824"
     variation       226
                     /gene="ISL2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376039978"
     variation       273
                     /gene="ISL2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:151069345"
     variation       321
                     /gene="ISL2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4636879"
     exon            327..589
                     /gene="ISL2"
                     /inference="alignment:Splign:1.39.8"
     variation       405
                     /gene="ISL2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368899411"
     variation       415
                     /gene="ISL2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:145221041"
     variation       432
                     /gene="ISL2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372925154"
     variation       433
                     /gene="ISL2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:147622507"
     variation       441
                     /gene="ISL2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201140408"
     variation       451
                     /gene="ISL2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:62028361"
     variation       477
                     /gene="ISL2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146252815"
     variation       560
                     /gene="ISL2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375968339"
     variation       582
                     /gene="ISL2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370935444"
     exon            590..873
                     /gene="ISL2"
                     /inference="alignment:Splign:1.39.8"
     variation       592
                     /gene="ISL2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376971357"
     variation       599
                     /gene="ISL2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371415237"
     variation       600
                     /gene="ISL2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374940510"
     variation       604
                     /gene="ISL2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200917260"
     variation       612
                     /gene="ISL2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:374903982"
     variation       624
                     /gene="ISL2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:367795331"
     variation       651
                     /gene="ISL2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200011600"
     variation       654
                     /gene="ISL2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200114561"
     variation       678
                     /gene="ISL2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367845589"
     variation       719
                     /gene="ISL2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375432836"
     variation       828
                     /gene="ISL2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372019352"
     variation       834
                     /gene="ISL2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145440339"
     variation       844
                     /gene="ISL2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:148825148"
     variation       858
                     /gene="ISL2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376307405"
     variation       862
                     /gene="ISL2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369945656"
     exon            874..1041
                     /gene="ISL2"
                     /inference="alignment:Splign:1.39.8"
     variation       885
                     /gene="ISL2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372503511"
     variation       890
                     /gene="ISL2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:202074846"
     variation       950
                     /gene="ISL2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148002891"
     variation       974
                     /gene="ISL2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140931798"
     variation       998
                     /gene="ISL2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:145105769"
     variation       1011
                     /gene="ISL2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138984043"
     variation       1026
                     /gene="ISL2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:115363632"
     variation       1028
                     /gene="ISL2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376002196"
     exon            1042..1798
                     /gene="ISL2"
                     /inference="alignment:Splign:1.39.8"
     variation       1080
                     /gene="ISL2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:150905281"
     variation       1114
                     /gene="ISL2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:138128983"
     variation       1116
                     /gene="ISL2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:114713527"
     variation       1190
                     /gene="ISL2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368069657"
     variation       1266
                     /gene="ISL2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:188500756"
     variation       1272
                     /gene="ISL2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:11854453"
     variation       1630
                     /gene="ISL2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:376804695"
     variation       1633
                     /gene="ISL2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:367641283"
     variation       1659
                     /gene="ISL2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369682025"
     variation       1662
                     /gene="ISL2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11634019"
     variation       1676
                     /gene="ISL2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112691062"
     variation       1738
                     /gene="ISL2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:181318526"
     variation       1742..1743
                     /gene="ISL2"
                     /replace=""
                     /replace="cc"
                     /db_xref="dbSNP:377674508"
ORIGIN      

gcaaagagccgaggccgggcgcgcgaccctcgtccttctgcccctggccgcacactttgcgcacatctctttttctgcatggtggatattatttttcattatccttttctgggtgctatgggtgatcattccaagaagaagcccgggacggccatgtgcgtgggctgcgggagtcagatccacgaccagtttatcctgcgggtgtcgcccgacctcgagtggcacgcggcctgcctcaagtgtgccgagtgcagccagtacctggacgagacgtgcacgtgcttcgtgagagacgggaagacctactgcaagcgggactacgtcaggctgttcggcatcaagtgcgccaagtgccaggtgggcttcagcagcagcgacctggtgatgagggcgcgggacagcgtgtaccacatcgagtgcttccgctgctccgtgtgcagccgccagctgctgcctggggacgagttctcgctgcgggagcacgagctgctctgccgcgccgaccacggcctcctgctcgagcgcgccgcggccggcagcccgcgcagccccggcccgcttcccggcgcccgcggcctgcatctgcccgacgctgggtcgggccggcagcccgcgttgcgcccgcacgtgcacaagcagacggagaagacgacccgcgtgcggactgtgctgaacgagaagcagctgcacactctgcggacctgctacgccgccaacccgcggcccgacgctctcatgaaggagcagctggtggagatgaccggcctgagcccgcgggtcatccgcgtctggttccagaacaagcgctgcaaggacaagaagaaatccattctcatgaagcagctgcagcagcagcagcacagcgacaagacgagccttcagggactgactgggacgcccctggtggcgggcagtcccatccgccatgagaacgccgtgcagggcagcgcagtggaggtgcagacgtaccagccgccgtggaaggcgctcagcgagtttgccctccagagcgacctggaccaacccgccttccaacagctggtctccttctccgagtccggctccctaggcaactcctccggcagcgacgtgacctccctgtcctcgcagctcccggacacccccaacagtatggtgccgagtcccgtggagacgtgagggggacccctccctgccagcccgcggacctcgcatgctccctgcatgagactcacccatgctcaggccattccagttccgaaagctctctcgccttcgtaattattctattgttatttatgagagagtaccgagagacacggtctggacagcccaaggcgccaggatgcaacctgctttcaccagactgcagacccctgctccgaggactcttagtttttcaaaaccagaatctgggacttaccagggttagctctgccctctcctctcctctctacgtggccgccgctctgtctctccacgccccacctgtgtccccatctcggccggcccggagctcgcccacgcggacccccgccctgccccagctcagcgctccctggcggcttcgcccgggctcctagcggggaaaaggaaggggataactcagaggaacagacactcaaactcccaaagcgcatgattgctgggaaacagtagaaaccagacttgccttgaaagtgtttaagttattcgacggaggacagagtatgtgagcctttgccgaacaaacaaacgtaagttattgttatttattgtgagaacagccagttcatagtgggacttgtattttgatcttaataaaaaataataacccgggaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa

//

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:64843 -> Molecular function: GO:0003677 [DNA binding] evidence: ISS
            GeneID:64843 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:64843 -> Molecular function: GO:0008270 [zinc ion binding] evidence: IEA
            GeneID:64843 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
            GeneID:64843 -> Biological process: GO:0021520 [spinal cord motor neuron cell fate specification] evidence: IEA
            GeneID:64843 -> Biological process: GO:0021524 [visceral motor neuron differentiation] evidence: IEA
            GeneID:64843 -> Biological process: GO:0031290 [retinal ganglion cell axon guidance] evidence: IEA
            GeneID:64843 -> Biological process: GO:0045665 [negative regulation of neuron differentiation] evidence: IEA
            GeneID:64843 -> Biological process: GO:0048666 [neuron development] evidence: TAS
            GeneID:64843 -> Biological process: GO:0048935 [peripheral nervous system neuron development] evidence: TAS
            GeneID:64843 -> Cellular component: GO:0005634 [nucleus] evidence: IC