2024-03-29 00:58:27, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_145690 3077 bp mRNA linear PRI 01-JUL-2013 DEFINITION Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 2, mRNA. ACCESSION NM_145690 VERSION NM_145690.2 GI:208973236 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 3077) AUTHORS Riou,P., Kjaer,S., Garg,R., Purkiss,A., George,R., Cain,R.J., Bineva,G., Reymond,N., McColl,B., Thompson,A.J., O'Reilly,N., McDonald,N.Q., Parker,P.J. and Ridley,A.J. TITLE 14-3-3 proteins interact with a hybrid prenyl-phosphorylation motif to inhibit G proteins JOURNAL Cell 153 (3), 640-653 (2013) PUBMED 23622247 REMARK GeneRIF: Study reports a high-affinity 14-3-3-binding site at the C terminus of Rnd3 consisting of both the Cys241-farnesyl moiety and a Rho-associated coiled coil containing protein kinase (ROCK)-dependent Ser240 phosphorylation site. REFERENCE 2 (bases 1 to 3077) AUTHORS Nishimura,Y., Komatsu,S., Ichikawa,D., Nagata,H., Hirajima,S., Takeshita,H., Kawaguchi,T., Arita,T., Konishi,H., Kashimoto,K., Shiozaki,A., Fujiwara,H., Okamoto,K., Tsuda,H. and Otsuji,E. TITLE Overexpression of YWHAZ relates to tumor cell proliferation and malignant outcome of gastric carcinoma JOURNAL Br. J. Cancer 108 (6), 1324-1331 (2013) PUBMED 23422756 REMARK GeneRIF: Overexpression of YWHAZ relates to tumor cell proliferation and malignant outcome of gastric carcinoma. REFERENCE 3 (bases 1 to 3077) AUTHORS Bergamaschi,A., Frasor,J., Borgen,K., Stanculescu,A., Johnson,P., Rowland,K., Wiley,E.L. and Katzenellenbogen,B.S. TITLE 14-3-3zeta as a predictor of early time to recurrence and distant metastasis in hormone receptor-positive and -negative breast cancers JOURNAL Breast Cancer Res. Treat. 137 (3), 689-696 (2013) PUBMED 23271328 REMARK GeneRIF: 14-3-3zeta as a predictor of early time to recurrence and distant metastasis in hormone receptor-positive and -negative breast cancers. REFERENCE 4 (bases 1 to 3077) AUTHORS Boon,S.S. and Banks,L. TITLE High-risk human papillomavirus E6 oncoproteins interact with 14-3-3zeta in a PDZ binding motif-dependent manner JOURNAL J. Virol. 87 (3), 1586-1595 (2013) PUBMED 23175360 REMARK GeneRIF: The interaction is direct and specific for the high-risk HPV E6 oncoproteins, although there are significant differences in the efficiencies with which HPV-16, HPV-18, and HPV-31 E6 oncoproteins can associate with 14-3-3zeta. REFERENCE 5 (bases 1 to 3077) AUTHORS Skwarczynska,M., Molzan,M. and Ottmann,C. TITLE Activation of NF-kappaB signalling by fusicoccin-induced dimerization JOURNAL Proc. Natl. Acad. Sci. U.S.A. 110 (5), E377-E386 (2013) PUBMED 23269842 REMARK GeneRIF: Data indicate that fusicoccin (FC)-mediated dimerization of the NF-kappaB-C terminus(CT) with a constitutively nuclear-localized 14-3-3 protein led to an NF-kappaB-specific cellular response by inducing IL-8 secretion. REFERENCE 6 (bases 1 to 3077) AUTHORS Koyama,S., Williams,L.T. and Kikuchi,A. TITLE Characterization of the interaction of Raf-1 with ras p21 or 14-3-3 protein in intact cells JOURNAL FEBS Lett. 368 (2), 321-325 (1995) PUBMED 7628630 REFERENCE 7 (bases 1 to 3077) AUTHORS Liu,D., Bienkowska,J., Petosa,C., Collier,R.J., Fu,H. and Liddington,R. TITLE Crystal structure of the zeta isoform of the 14-3-3 protein JOURNAL Nature 376 (6536), 191-194 (1995) PUBMED 7603574 REFERENCE 8 (bases 1 to 3077) AUTHORS Sato,T., Irie,S., Kitada,S. and Reed,J.C. TITLE FAP-1: a protein tyrosine phosphatase that associates with Fas JOURNAL Science 268 (5209), 411-415 (1995) PUBMED 7536343 REFERENCE 9 (bases 1 to 3077) AUTHORS Kawamoto,S., Shoji,M., Setoguchi,Y., Kato,M., Hashizume,S., Ichikawa,A., Osada,K., Katakura,Y., Tachibana,H. and Murakami,H. TITLE Molecular cloning of the 31 kDa cytosolic phospholipase A2, as an antigen recognized by the lung cancer-specific human monoclonal antibody, AE6F4 JOURNAL Cytotechnology 17 (2), 103-108 (1995) PUBMED 7547034 REFERENCE 10 (bases 1 to 3077) AUTHORS Zupan,L.A., Steffens,D.L., Berry,C.A., Landt,M. and Gross,R.W. TITLE Cloning and expression of a human 14-3-3 protein mediating phospholipolysis. Identification of an arachidonoyl-enzyme intermediate during catalysis JOURNAL J. Biol. Chem. 267 (13), 8707-8710 (1992) PUBMED 1577711 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CN276619.1, BC072426.1 and BM783874.1. On Oct 8, 2008 this sequence version replaced gi:21735624. Summary: This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene. [provided by RefSeq, Oct 2008]. Transcript Variant: This variant (2) represents the longest transcript. All six transcripts encode the same protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC072426.1, BX440479.2 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025088 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-105 CN276619.1 1-105 106-2960 BC072426.1 1-2855 2961-3077 BM783874.1 221-337 FEATURES Location/Qualifiers source 1..3077 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="8" /map="8q23.1" gene 1..3077 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /note="tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide" /db_xref="GeneID:7534" /db_xref="HGNC:12855" /db_xref="HPRD:03183" /db_xref="MIM:601288" exon 1..201 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /inference="alignment:Splign:1.39.8" misc_feature 9..11 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /note="upstream in-frame stop codon" variation 16 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /replace="a" /replace="g" /db_xref="dbSNP:41530446" STS 153..973 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /db_xref="UniSTS:483410" exon 202..506 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /inference="alignment:Splign:1.39.8" CDS 213..950 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /note="14-3-3 delta; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, delta polypeptide; 14-3-3 zeta; phospholipase A2; protein kinase C inhibitor protein-1; tyrosine 3/tryptophan 5 -monooxygenase activation protein, zeta polypeptide; 14-3-3 protein/cytosolic phospholipase A2; protein kinase C inhibitor protein 1" /codon_start=1 /product="14-3-3 protein zeta/delta" /protein_id="NP_663723.1" /db_xref="GI:21735625" /db_xref="CCDS:CCDS6290.1" /db_xref="GeneID:7534" /db_xref="HGNC:12855" /db_xref="HPRD:03183" /db_xref="MIM:601288" /translation="
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
" misc_feature 213..215 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /experiment="experimental evidence, no additional details recorded" /note="N-acetylmethionine; propagated from UniProtKB/Swiss-Prot (P63104.1); acetylation site" misc_feature 216..902 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /note="14-3-3 beta and zeta isoforms of 14-3-3 protein; Region: 14-3-3_beta_zeta; cd10022" /db_xref="CDD:206758" misc_feature 219..221 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /experiment="experimental evidence, no additional details recorded" /note="N6-acetyllysine; propagated from UniProtKB/Swiss-Prot (P63104.1); acetylation site" misc_feature order(225..227,234..239,246..251,255..260,264..266, 273..275,384..386,393..395,405..407,435..437,444..449, 456..458,465..470,477..479) /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:206758" misc_feature 285..287 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /experiment="experimental evidence, no additional details recorded" /note="S-nitrosylation site; modified site" misc_feature order(333..338,345..350,357..359,561..563,570..572, 591..596,705..707,717..719,726..731,738..740,837..851, 858..863,870..872,882..884) /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /note="peptide binding site [polypeptide binding]; other site" /db_xref="CDD:206758" misc_feature 378..380 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /inference="non-experimental evidence, no additional details recorded" /note="Interaction with phosphoserine on interacting protein (By similarity); propagated from UniProtKB/Swiss-Prot (P63104.1); other site" misc_feature 384..386 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine, by PKA and PKB/AKT1; propagated from UniProtKB/Swiss-Prot (P63104.1); phosphorylation site" misc_feature 384..386 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:11882" misc_feature 384..386 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:01501" misc_feature 384..386 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:01261" misc_feature 384..386 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:03770" misc_feature 384..386 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" misc_feature 414..416 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /experiment="experimental evidence, no additional details recorded" /note="N6-acetyllysine; propagated from UniProtKB/Swiss-Prot (P63104.1); acetylation site" misc_feature 591..593 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /inference="non-experimental evidence, no additional details recorded" /note="Interaction with phosphoserine on interacting protein (By similarity); propagated from UniProtKB/Swiss-Prot (P63104.1); other site" misc_feature 762..764 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine, by MAPK8; propagated from UniProtKB/Swiss-Prot (P63104.1); phosphorylation site" misc_feature 762..764 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:01261" misc_feature 762..764 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:03100" misc_feature 831..833 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (P63104.1); phosphorylation site" misc_feature 906..908 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /experiment="experimental evidence, no additional details recorded" /note="Phosphothreonine, by CK1; propagated from UniProtKB/Swiss-Prot (P63104.1); phosphorylation site" misc_feature 906..908 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:02739" STS 413..656 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /standard_name="PMC150726P7" /db_xref="UniSTS:271079" variation 439 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /replace="a" /replace="g" /db_xref="dbSNP:11551365" variation 473 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /replace="a" /replace="g" /db_xref="dbSNP:41473144" exon 507..630 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /inference="alignment:Splign:1.39.8" exon 631..794 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /inference="alignment:Splign:1.39.8" exon 795..890 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /inference="alignment:Splign:1.39.8" exon 891..3067 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /inference="alignment:Splign:1.39.8" variation 1036 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /replace="g" /replace="t" /db_xref="dbSNP:11551354" STS 1219..1312 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /standard_name="PMC126239P3" /db_xref="UniSTS:270535" variation 1308 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /replace="g" /replace="t" /db_xref="dbSNP:11551357" STS 1338..2086 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /standard_name="YWHAZ_1120.2" /db_xref="UniSTS:281082" variation 1417 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /replace="c" /replace="t" /db_xref="dbSNP:11545396" polyA_signal 1923..1928 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" polyA_site 1954 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" variation 2437 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /replace="c" /replace="t" /db_xref="dbSNP:11551356" variation 2722 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /replace="c" /replace="g" /db_xref="dbSNP:1062376" variation 2742 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /replace="a" /replace="c" /db_xref="dbSNP:1062382" variation 2868 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /replace="c" /replace="t" /db_xref="dbSNP:1139382" variation 2884 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /replace="a" /replace="c" /db_xref="dbSNP:1062393" polyA_signal 2897..2902 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" polyA_site 2920 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" polyA_site 2960 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" variation 2962 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /replace="a" /replace="c" /db_xref="dbSNP:3203463" polyA_signal 3049..3054 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" polyA_site 3067 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" ORIGIN
gcagcgtttgacgtcatcgtgcgtgtggtgcccctgctgccggggctggtgattggaggaaaccccgtgtctgcggagcggctgtagcctgtgagcagcgagatccagggacagagtctcagcctcgccgctgctgccgccgccgccgcccagagactgctgagcccgtccgtccgccgccaccacccactccggacacagaacatccagtcatggataaaaatgagctggttcagaaggccaaactggccgagcaggctgagcgatatgatgacatggcagcctgcatgaagtctgtaactgagcaaggagctgaattatccaatgaggagaggaatcttctctcagttgcttataaaaatgttgtaggagcccgtaggtcatcttggagggtcgtctcaagtattgaacaaaagacggaaggtgctgagaaaaaacagcagatggctcgagaatacagagagaaaattgagacggagctaagagatatctgcaatgatgtactgtctcttttggaaaagttcttgatccccaatgcttcacaagcagagagcaaagtcttctatttgaaaatgaaaggagattactaccgttacttggctgaggttgccgctggtgatgacaagaaagggattgtcgatcagtcacaacaagcataccaagaagcttttgaaatcagcaaaaaggaaatgcaaccaacacatcctatcagactgggtctggcccttaacttctctgtgttctattatgagattctgaactccccagagaaagcctgctctcttgcaaagacagcttttgatgaagccattgctgaacttgatacattaagtgaagagtcatacaaagacagcacgctaataatgcaattactgagagacaacttgacattgtggacatcggatacccaaggagacgaagctgaagcaggagaaggaggggaaaattaaccggccttccaacttttgtctgcctcattctaaaatttacacagtagaccatttgtcatccatgctgtcccacaaatagttttttgtttacgatttatgacaggtttatgttacttctatttgaatttctatatttcccatgtggtttttatgtttaatattaggggagtagagccagttaacatttagggagttatctgttttcatcttgaggtggccaatatggggatgtggaatttttatacaagttataagtgtttggcatagtacttttggtacattgtggcttcaaaagggccagtgtaaaactgcttccatgtctaagcaaagaaaactgcctacatactggtttgtcctggcggggaataaaagggatcattggttccagtcacaggtgtagtaattgtgggtactttaaggtttggagcacttacaaggctgtggtagaatcataccccatggataccacatattaaaccatgtatatctgtggaatactcaatgtgtacacctttgactacagctgcagaagtgttcctttagacaaagttgtgacccattttactctggataagggcagaaacggttcacattccattatttgtaaagttacctgctgttagctttcattatttttgctacactcattttatttgtatttaaatgttttaggcaacctaagaacaaatgtaaaagtaaagatgcaggaaaaatgaattgcttggtattcattacttcatgtatatcaagcacagcagtaaaacaaaaacccatgtatttaacttttttttaggatttttgcttttgtgatttttttttttttgatacttgcctaacatgcatgtgctgtaaaaatagttaacagggaaataacttgagatgatggctagctttgtttaatgtcttatgaaattttcatgaacaatccaagcataattgttaagaacacgtgtattaaattcatgtaagtggaataaaagttttatgaatggacttttcaactactttctctacagcttttcatgtaaattagtcttggttctgaaacttctctaaaggaaattgtacattttttgaaatttattccttattccctcttggcagctaatgggctcttaccaagtttaaacacaaaatttatcataacaaaaatactactaatataactactgtttccatgtcccatgatcccctctcttcctccccaccctgaaaaaaatgagttcctattttttctgggagagggggggattgattagaaaaaaatgtagtgtgttccatttaaaattttggcatatggcattttctaacttaggaagccacaatgttcttggcccatcatgacattgggtagcattaactgtaagttttgtgcttccaaatcactttttggtttttaagaatttcttgatactcttatagcctgccttcaattttgatcctttattctttctatttgtcaggtgcacaagattaccttcctgttttagccttctgtcttgtcaccaaccattcttacttggtggccatgtacttggaaaaaggccgcatgatctttctggctccactcagtgtctaaggcaccctgcttcctttgcttgcatcccacagactatttccctcatcctatttactgcagcaaatctctccttagttgatgagactgtgtttatctccctttaaaaccctacctatcctgaatggtctgtcattgtctgcctttaaaatccttcctctttcttcctcctctattctctaaataatgatggggctaagttatacccaaagctcactttacaaaatatttcctcagtactttgcagaaaacaccaaacaaaaatgccattttaaaaaaggtgtattttttcttttagaatgtaagctcctcaagagcagggacaatgttttctgtatgttctattgtgcctagtacactgtaaatgctcaataaatattgatgatgggaggcagtgagtcttgatgataagggtgagaaactgaaatcccaaacactgttttgttgcttgttttattatgacctcagattaaattgggaaatattggcccttttgaataattgtcccaaatattacattcaaataaaagtgcaatggagaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:7534 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:7534 -> Molecular function: GO:0008134 [transcription factor binding] evidence: IPI GeneID:7534 -> Molecular function: GO:0019901 [protein kinase binding] evidence: IPI GeneID:7534 -> Molecular function: GO:0019904 [protein domain specific binding] evidence: IEA GeneID:7534 -> Molecular function: GO:0032403 [protein complex binding] evidence: IEA GeneID:7534 -> Biological process: GO:0002553 [histamine secretion by mast cell] evidence: IEA GeneID:7534 -> Biological process: GO:0006626 [protein targeting to mitochondrion] evidence: IEA GeneID:7534 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS GeneID:7534 -> Biological process: GO:0007165 [signal transduction] evidence: TAS GeneID:7534 -> Biological process: GO:0007596 [blood coagulation] evidence: TAS GeneID:7534 -> Biological process: GO:0010467 [gene expression] evidence: TAS GeneID:7534 -> Biological process: GO:0016044 [cellular membrane organization] evidence: TAS GeneID:7534 -> Biological process: GO:0016070 [RNA metabolic process] evidence: TAS GeneID:7534 -> Biological process: GO:0016071 [mRNA metabolic process] evidence: TAS GeneID:7534 -> Biological process: GO:0030168 [platelet activation] evidence: TAS GeneID:7534 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS GeneID:7534 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: TAS GeneID:7534 -> Biological process: GO:1900740 [positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway] evidence: TAS GeneID:7534 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS GeneID:7534 -> Cellular component: GO:0005737 [cytoplasm] evidence: TAS GeneID:7534 -> Cellular component: GO:0005739 [mitochondrion] evidence: IEA GeneID:7534 -> Cellular component: GO:0005829 [cytosol] evidence: TAS GeneID:7534 -> Cellular component: GO:0014069 [postsynaptic density] evidence: IEA GeneID:7534 -> Cellular component: GO:0030659 [cytoplasmic vesicle membrane] evidence: TAS GeneID:7534 -> Cellular component: GO:0031252 [cell leading edge] evidence: IEA GeneID:7534 -> Cellular component: GO:0042470 [melanosome] evidence: IEA GeneID:7534 -> Cellular component: GO:0043234 [protein complex] evidence: IEA GeneID:7534 -> Cellular component: GO:0048471 [perinuclear region of cytoplasm] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.