GGRNA Home | Help | Advanced search

2020-10-24 06:11:50, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_145175               6366 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens family with sequence similarity 84, member A (FAM84A),
            mRNA.
ACCESSION   NM_145175
VERSION     NM_145175.2  GI:281371407
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 6366)
  AUTHORS   Fox,C.S., Liu,Y., White,C.C., Feitosa,M., Smith,A.V.,
            Heard-Costa,N., Lohman,K., Johnson,A.D., Foster,M.C.,
            Greenawalt,D.M., Griffin,P., Ding,J., Newman,A.B., Tylavsky,F.,
            Miljkovic,I., Kritchevsky,S.B., Launer,L., Garcia,M.,
            Eiriksdottir,G., Carr,J.J., Gudnason,V., Harris,T.B., Cupples,L.A.
            and Borecki,I.B.
  CONSRTM   GIANT Consortium; MAGIC Consortium; GLGC Consortium
  TITLE     Genome-wide association for abdominal subcutaneous and visceral
            adipose reveals a novel locus for visceral fat in women
  JOURNAL   PLoS Genet. 8 (5), E1002695 (2012)
   PUBMED   22589738
REFERENCE   2  (bases 1 to 6366)
  AUTHORS   Pebernard,S., Perry,J.J., Tainer,J.A. and Boddy,M.N.
  TITLE     Nse1 RING-like domain supports functions of the Smc5-Smc6
            holocomplex in genome stability
  JOURNAL   Mol. Biol. Cell 19 (10), 4099-4109 (2008)
   PUBMED   18667531
  REMARK    GeneRIF: Nse1 RING-like motif is a protein-protein interaction
            domain required for Smc5-Smc6 holocomplex integrity and recruitment
            to, or retention at, DNA lesions
REFERENCE   3  (bases 1 to 6366)
  AUTHORS   Kobayashi,T., Masaki,T., Sugiyama,M., Atomi,Y., Furukawa,Y. and
            Nakamura,Y.
  TITLE     A gene encoding a family with sequence similarity 84, member A
            (FAM84A) enhanced migration of human colon cancer cells
  JOURNAL   Int. J. Oncol. 29 (2), 341-347 (2006)
   PUBMED   16820875
  REMARK    GeneRIF: up-regulation of FAM84A may play a critical role in
            progression of colon cancer
REFERENCE   4  (bases 1 to 6366)
  AUTHORS   Hillier,L.W., Graves,T.A., Fulton,R.S., Fulton,L.A., Pepin,K.H.,
            Minx,P., Wagner-McPherson,C., Layman,D., Wylie,K., Sekhon,M.,
            Becker,M.C., Fewell,G.A., Delehaunty,K.D., Miner,T.L., Nash,W.E.,
            Kremitzki,C., Oddy,L., Du,H., Sun,H., Bradshaw-Cordum,H., Ali,J.,
            Carter,J., Cordes,M., Harris,A., Isak,A., van Brunt,A., Nguyen,C.,
            Du,F., Courtney,L., Kalicki,J., Ozersky,P., Abbott,S.,
            Armstrong,J., Belter,E.A., Caruso,L., Cedroni,M., Cotton,M.,
            Davidson,T., Desai,A., Elliott,G., Erb,T., Fronick,C., Gaige,T.,
            Haakenson,W., Haglund,K., Holmes,A., Harkins,R., Kim,K.,
            Kruchowski,S.S., Strong,C.M., Grewal,N., Goyea,E., Hou,S., Levy,A.,
            Martinka,S., Mead,K., McLellan,M.D., Meyer,R., Randall-Maher,J.,
            Tomlinson,C., Dauphin-Kohlberg,S., Kozlowicz-Reilly,A., Shah,N.,
            Swearengen-Shahid,S., Snider,J., Strong,J.T., Thompson,J.,
            Yoakum,M., Leonard,S., Pearman,C., Trani,L., Radionenko,M.,
            Waligorski,J.E., Wang,C., Rock,S.M., Tin-Wollam,A.M., Maupin,R.,
            Latreille,P., Wendl,M.C., Yang,S.P., Pohl,C., Wallis,J.W.,
            Spieth,J., Bieri,T.A., Berkowicz,N., Nelson,J.O., Osborne,J.,
            Ding,L., Meyer,R., Sabo,A., Shotland,Y., Sinha,P., Wohldmann,P.E.,
            Cook,L.L., Hickenbotham,M.T., Eldred,J., Williams,D., Jones,T.A.,
            She,X., Ciccarelli,F.D., Izaurralde,E., Taylor,J., Schmutz,J.,
            Myers,R.M., Cox,D.R., Huang,X., McPherson,J.D., Mardis,E.R.,
            Clifton,S.W., Warren,W.C., Chinwalla,A.T., Eddy,S.R., Marra,M.A.,
            Ovcharenko,I., Furey,T.S., Miller,W., Eichler,E.E., Bork,P.,
            Suyama,M., Torrents,D., Waterston,R.H. and Wilson,R.K.
  TITLE     Generation and annotation of the DNA sequences of human chromosomes
            2 and 4
  JOURNAL   Nature 434 (7034), 724-731 (2005)
   PUBMED   15815621
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BI547868.1, AJ417080.1, AC011897.10 and BX113099.1.
            On Dec 18, 2009 this sequence version replaced gi:21553328.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BI547868.1, AJ417080.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025082, ERS025083 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-46                BI547868.1         6-51
            47-503              AJ417080.1         1-457
            504-504             AC011897.10        42965-42965
            505-2632            AJ417080.1         459-2586
            2633-6040           AC011897.10        45094-48501
            6041-6222           BX113099.1         11-192
            6223-6316           AC011897.10        48684-48777
            6317-6366           BX113099.1         287-336
FEATURES             Location/Qualifiers
     source          1..6366
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="2"
                     /map="2p24.3"
     gene            1..6366
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /note="family with sequence similarity 84, member A"
                     /db_xref="GeneID:151354"
                     /db_xref="HGNC:20743"
                     /db_xref="MIM:611234"
     exon            1..252
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /inference="alignment:Splign:1.39.8"
     variation       4
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368989671"
     variation       188
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:115912907"
     exon            253..6355
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /inference="alignment:Splign:1.39.8"
     variation       259
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372453481"
     variation       279
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78607687"
     CDS             289..1167
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /note="neurological/sensory 1; neurologic sensory protein
                     1"
                     /codon_start=1
                     /product="protein FAM84A"
                     /protein_id="NP_660158.2"
                     /db_xref="GI:281371408"
                     /db_xref="CCDS:CCDS1684.1"
                     /db_xref="GeneID:151354"
                     /db_xref="HGNC:20743"
                     /db_xref="MIM:611234"
                     /translation="
MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSRHHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQPAPEPPAPAPHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNSWYRYRPLVAELVVQNACGHLGLKSEEICWTNSESFAAWCRFGKREFKAGGEVPAGTQPPQQQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRVLQELADLVDDKE
"
     misc_feature    724..957
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /note="Lecithin retinol acyltransferase; Region: LRAT;
                     pfam04970"
                     /db_xref="CDD:203136"
     variation       354
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:78781160"
     variation       394
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201609259"
     variation       428
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148592039"
     variation       448
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374608638"
     variation       458
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:78327295"
     variation       459
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200984957"
     variation       525
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112489085"
     variation       546
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370916643"
     variation       686
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:17852411"
     variation       792
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:71435442"
     variation       808
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201168104"
     variation       813
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371515886"
     variation       855
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:199808298"
     variation       983
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374702675"
     variation       986
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151113082"
     variation       1032
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:367691817"
     variation       1056
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190859188"
     variation       1059
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147914327"
     variation       1097
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145966184"
     variation       1142
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138567856"
     variation       1158
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17852410"
     variation       1166
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148059470"
     variation       1178
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374854100"
     variation       1216
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371981437"
     variation       1425
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113956029"
     variation       1482
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:181313863"
     variation       1737
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371043417"
     variation       1771
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:114662233"
     variation       1816
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:150617072"
     variation       1928
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:185670446"
     variation       2002
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:139948660"
     variation       2011
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374066235"
     variation       2020
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:149856983"
     STS             2150..2269
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /standard_name="RH99165"
                     /db_xref="UniSTS:91362"
     variation       2511
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145880057"
     variation       2592
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79772157"
     variation       2656
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:12994914"
     variation       2971
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:116546729"
     variation       3180
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1062842"
     variation       3209
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:140067201"
     variation       3270
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145596559"
     variation       3276..3279
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace=""
                     /replace="attt"
                     /db_xref="dbSNP:376229411"
     variation       3286
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:190824730"
     STS             3389..3513
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /standard_name="SHGC-36750"
                     /db_xref="UniSTS:5425"
     STS             3408..3523
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /standard_name="D2S1661E"
                     /db_xref="UniSTS:46129"
     variation       3537
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147796819"
     variation       3542
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:182962264"
     variation       3573..3574
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:34482321"
     variation       3588
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79536957"
     variation       3685
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141239595"
     variation       3702
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:76092855"
     variation       3788
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146922007"
     variation       3859
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:189198727"
     variation       3941
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368080433"
     variation       3984
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150937215"
     variation       4015..4016
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:144790670"
     variation       4024
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:140739153"
     variation       4033
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:77784774"
     variation       4298
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:192030970"
     variation       4338
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:13428391"
     variation       4456
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183864078"
     variation       4536..4537
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:72296554"
     variation       4557
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187625512"
     variation       4657
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:71435443"
     variation       4744
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:191241618"
     variation       4792
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115949290"
     variation       4859
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:184144561"
     variation       4869
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:186915195"
     variation       4925
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368640064"
     variation       4961
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:192230475"
     variation       5135
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185225898"
     variation       5167
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190140115"
     variation       5247
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:112854199"
     variation       5273
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79262108"
     variation       5347
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372182325"
     variation       5412..5413
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace=""
                     /replace="ac"
                     /db_xref="dbSNP:148609735"
     variation       5413..5414
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace=""
                     /replace="ac"
                     /replace="ca"
                     /db_xref="dbSNP:34456742"
     variation       5430..5431
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace=""
                     /replace="ca"
                     /db_xref="dbSNP:72291059"
     variation       5438..5439
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace=""
                     /replace="ca"
                     /replace="caca"
                     /db_xref="dbSNP:68180413"
     variation       5512
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182147915"
     variation       5561
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185537693"
     variation       5704
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188453344"
     variation       5791
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138671266"
     variation       5950
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:180869694"
     variation       5958
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141746755"
     variation       6003
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:145453315"
     variation       6014
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2196267"
     STS             6163..6283
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /standard_name="RH78874"
                     /db_xref="UniSTS:10039"
     variation       6223
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1865456"
     variation       6233
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138274916"
     variation       6316
                     /gene="FAM84A"
                     /gene_synonym="NSE1; PP11517"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:8849"
ORIGIN      
ggctacttagagtcgtcggcgcggcggtgggaaagcagagccgagccgggactgtccagtgggagcaggcgccccggccagcgcagacctggaggcgcacgggcgccgcaccgcacgattcggctcggggtagagcggagccgcagccccacgcgcagcccaggacccactcgccaccgccgcttcctcagcacccatggggaccaggagactttaaaggagtttggggtttcgggagcagggaaatcacggatccccgctcctggccctcgcctcgccacctcattgatgggcaaccaactggaccgcatcacccacctcaactacagcgagttgcccacaggggacccgtcggggattgaaaaggacgaactgcgggtcggggttgcctacttcttctcggatgatgaggaagacctggacgaacgcgggcagcccgacaagtttggcgtgaaggcccccccgggttgcaccccctgcccggagagccccagccgccaccaccaccacctgctgcaccagctggtcctcaacgagactcagttttccgcctttcggggccaggaatgcatcttttccaaagtgagcggtggccctcagggcgccgacctaagcgtctacgcggtcaccgcgctgccagcgctctgcgaacccggcgacctgctggagctgctgtggctgcagcccgcgccggagccgcccgcgcccgccccgcactgggccgtctacgtgggcggcgggcagatcatccacctgcaccaaggcgagatccgccaggacagcctgtatgaggcgggcgcggccaacgtgggccgggtggtgaatagctggtaccgctaccgcccgctggtggccgagctggtggtgcagaacgcctgcggccacctgggcctcaagagcgaggagatctgctggacgaactcggagagcttcgccgcctggtgccgctttggcaagcgggagttcaaggcgggaggggaggtgccggcaggcacgcagcccccgcagcagcagtactatctcaaggtgcacctgggagagaacaaggtccacaccgccaggtttcacagcctggaagacctcatccgcgagaagcgccgtatcgacgccagcggccgcctgcgagtgctccaggagctcgccgacctcgtggacgacaaggagtagccgcctaggggctgccggcccctctgcctcccccgcacctcgctcccttcccttccccgcacccggacttcgcagtcagcggttctcaacctctgccccgccccgccacgcgcgtccgccgccggtggcccgggcccgggctgcacccccgcatccccaagccagcggcaggaagtctcaggaactgccccagggccgaaagggcgccgctgcgagcgcctggctgacagccacagcggtggtgacggtgctgggagaccccgcgtgcgctttccccttgagatgtaaaccgggaacggggaaggggctgaggggagaaaggacatggccttccccgcgagtccatggccagtgactgtggcccgactcgaaaacaaccctcttctcaaaagggaccatcaccgccccgagcgtgcgcacacagaccggtcggaggcgagaactggtctctacagggcacagttcagctcctctgtggatgcgtccccagatcgcaggatttccaagaaatcgagcctgtcccttgtgcacttgggaataattccccaagacagcacttcgggattccgggttatcctgaggctgcccgggacttttccagctctccagccccaggtctcctgacattgtgttccaggctgcgggctaagccagacagtgtttgcctccggttctttccaccgtgggaagcgaacgccacccccacccgcctttgcctgcgagtctccctcgctggcagaagggaagccggcccggtcccgggaggaagatggcgctgcgaattcggtgaggacagccggccccgcccccgacaaggagctcgctcgttcacctggtgtctgggaacttgaatgtgtgaagggcgcttattgttctgaacccttgattgctccctcctcgggctgcatttcaaaaatagtcatatttttaaaggagttggaggagagggagggggaggacatggcaccattccagaaaccagcattgttacaacaccatagccagtatatttagtttggcttttcctaacatagaaatcttcaaagctggggaagtggaaataaagttttaaaaatgagagagcagttttccaactatgtcaacaaagcctatcgtgttgatgtttttattgaccattttagcaacaggctaataaaatttcaaattgaaatttttattttcatggctttaatccatgatagtttaaatactgggggccattaagagtggatgtagctaagagcttagctaacattgccttttcactctatttttctcagatattgtaagcattctgtttttcaatattgtagttaattttttggctttcaacagcagccctagtaatggtggagttgttaattaatgtgtatattgtactgaatttctgtcagttaaggggttcactgctttggtggaaattggtggaaattgctagcaggttccacgatgtttatttttttctccatgttgtatatcattaccatttcacatacgcgtttctatttttcttcctctcctcctgatctccttaaaaatgaatctagagttggtggctttttccccctcctctttggccagttccacagttcagttcttcctgaaaacagggatgatgaacttgtaggatcaggacaaatgtgtgtttttcaaaaacttaaggctgggtgtgaaacaccttctgtggacaaggatttgtaaacttctctcctccctccagctgcggccccagcctaactgatagttacttgattcagtgtgctagacacttaaatagcatctatgtctctttcaagggaatttgtcaaataatgctgtttagctaattgttgcaagcaattgcatattaacagctgtgattttgttggacagcaagtattatggccaaagccagtttcttggcatttcaaaaataatgcaataaaaactagttgaggttagctgaggctggaaatgcctttttcatggtaaatgattcacttctatatttttctttctttttctttttttttctttggttttcatcctggattcatcccctgatcttaaatcaaaacgtcagatcaatgaactatgaactaaagtatttttcttaagcctattgagtgatttattttttaaaaaatgtttaaatgcatatgcttttctttcagcacaaacaacagcaaaaacttttgtaataactaacttacctttgcatgtatgaagaactgagtcatttatttccctaacttactcctctttcaagtaacaggtggcagatcataaaatgaattctttattgtatctacacactccacattctttactgtgtcctactactgtatcttggctccctgctgtattaaacaccatcttaagcacttgttcctgcaggactccttcttgacattttgtctcccccttcaaagtcactcaaagagtgggacttcatcaaaagaaatgaattagtctctatcacaccgaatactaagatttatttcctctgatggtacatagatttctctctcactaagagggtcactctcatagaggaatgtcttgtcagttttatacttgctgaggctagactgacaataaaaatgagctgggcagttaaattagcatttgttactatattggcctataaaggatcaggttgatgataatacctctaaaaatatgcaataataaaacaatagttatgaaagaaacttgaaaggtttgcaaggtttctcctatccctgttaaaattatcatttattatctctttgtcagtgttagtaaggtaacccatgacagaataatttgagtgatagttcatcatgcagaggatatgatcaagatattacctaatggttttatcctgaaaaaggtgtatacttttagggcactgttaacaatgcgagtgaaaccaagatggtgcaagttccctttgcagatggcgtgggcacacttgatttttattatgagtgaatgtaatctttctgtattttaccagagttacagcaattacctgaaaagtttcctaacattttaataatgttagggatttcgttttggttttagttgtcctcaagagacaacaggttcacagtaatttccatgatgttgggtgtggctaagctggggattggttctgttccccctgctcccgtgtagagaaaagctatatttatactgcattctttctcaactttcaggtaaaacaaactatgatttaaaaaaagaaaaaagaaaagacaggtacttttacttcaaagagtgctttgctacatttttatttaaaccaaaaatcaaataaaataaggaggggggctgggtatactttaaacaaaaccagtcctgaaatgctgttattctcaaagtacattccaaaaaaaaaaaaaaaaaaaaactatagaatttacgtatgttacatttttaagtatgagttaaattgatataaagtgttcctcaatatttaataatgtaagctgttgtcatgacagtattttttaaaaataataacgtatattatagttacgaaacacttgtgccagattagaacatcaagcacagaagcagctgtatgatttacctgtttttttgaaactttaatgtttaccttcccctatgtttaatttttctgtggtgaacacttttgttagaacatggcttttttatttttcttggaaaaatatgctattagtatttacaaaataattaattacctgaataagcagtatatactaaaagtcttcaaacattactttattgattacttatgttttgtggtgcgctttcaacatccctaagagttaaatgtcttagtcatctaatacatggaacagggtcaaacttcaatgaaattaatacttattgcacaatcataatatagcaacctaattttcttttatttataggcatatctttaaagctttcttctcttttttgaacaaatgaagagaatccagttagtttttgcctttcagaggtgatttgccacgtgcacaaagggtctgtaggtgaaaagacaggcttttgggtttcttgaaacatcaaaaactgaatttagagaatggttatctaacactcaagtcaatgttttttttgaaattactagctattggtataatatacatatatgtacatgtatacatatacatacacacatatgtacatttacacatatgtaagtatacactcatatacatatatacacatgtatatatacttgtgtacacatacatttttgcctatagctagcaattatttcattcagatacacacacacacacacacacacacaggctacttaaaatagagagtgacttgagatatacaaaaacaggaagaaaagccctggaggtcatatagctaatgtataactgcacagcaagcagctatgtctaaagctaacaataaaaagaaaatgtgggagttgtgcaattagttttattctcattttttggaagaatatgttcctggtttctctaactaaaaggaaaaaattcaaaggaaagttgtaaatattaggaagtaactgaaaaataagaagcaagataaagtggggaggctatgagatcatataatgagctaataaacttttcaacaggggacacctgttctcccttctaactgaagacactaaagagaagctaagatcctatctttcaatcatttagtaattcataaaatcccattatttcataactcaaagtttacctttgaggttgtatgtttacctcatttgaactcgaaatagaagaggtttaagtatttgaataagttgggaaaaaaaggaaaaatagtcttccctgcccttgtcactgatggtgacactacttgtaattactgtattttttggcagaacactcagatgaacagattcctatgctgtggacttttatcattctttttgatggctgatagtagaaagcacacagtaggtactccataaatgtaagactatggcagctgtctagtacaagtgcttctcactgattcttggttaccaggaaaaccagaaagcccgtcacttgccttgcctgcaaaggcgagcctaaagaaatttctctaaccaaaattggcaggttctttccaccacaaaaggctcttggaaatataacttatggggcttaaggctaatttgagttgaagggtatttgtaatatttgatttgcttttagcagagaaaacaataaaagaatccaggaaaagtagaaaaaaaaaaaaaaa
//

Annotations:



by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.