Home |
Help |
Advanced search
2024-04-20 17:29:59, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_144781 2098 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens programmed cell death 2 (PDCD2), transcript variant 2,
mRNA.
ACCESSION NM_144781
VERSION NM_144781.2 GI:313850992
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2098)
AUTHORS Kokorina,N.A., Granier,C.J., Zakharkin,S.O., Davis,S., Rabson,A.B.
and Sabaawy,H.E.
TITLE PDCD2 knockdown inhibits erythroid but not megakaryocytic lineage
differentiation of human hematopoietic stem/progenitor cells
JOURNAL Exp. Hematol. 40 (12), 1028-1042 (2012)
PUBMED 22922207
REMARK GeneRIF: PDCD2 has a novel regulatory role in human hematopoiesis
and is essential for erythroid development.
REFERENCE 2 (bases 1 to 2098)
AUTHORS Baron,B.W., Hyjek,E., Gladstone,B., Thirman,M.J. and Baron,J.M.
TITLE PDCD2, a protein whose expression is repressed by BCL6, induces
apoptosis in human cells by activation of the caspase cascade
JOURNAL Blood Cells Mol. Dis. 45 (2), 169-175 (2010)
PUBMED 20605493
REMARK GeneRIF: Transfection of a construct expressing PDCD2 induces
apoptosis in human cell lines through activation of the caspase
cascade.
REFERENCE 3 (bases 1 to 2098)
AUTHORS Fukae,J., Sato,S., Shiba,K., Sato,K., Mori,H., Sharp,P.A.,
Mizuno,Y. and Hattori,N.
TITLE Programmed cell death-2 isoform1 is ubiquitinated by parkin and
increased in the substantia nigra of patients with autosomal
recessive Parkinson's disease
JOURNAL FEBS Lett. 583 (3), 521-525 (2009)
PUBMED 19146857
REMARK GeneRIF: parkin interacts with programmed cell death-2 isoform 1
(PDCD2-1)
REFERENCE 4 (bases 1 to 2098)
AUTHORS Baron,B.W., Zeleznik-Le,N., Baron,M.J., Theisler,C., Huo,D.,
Krasowski,M.D., Thirman,M.J., Baron,R.M. and Baron,J.M.
TITLE Repression of the PDCD2 gene by BCL6 and the implications for the
pathogenesis of human B and T cell lymphomas
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 104 (18), 7449-7454 (2007)
PUBMED 17468402
REMARK GeneRIF: repression of PDCD2 by BCL6 is likely important in the
pathogenesis of certain human lymphomas
REFERENCE 5 (bases 1 to 2098)
AUTHORS Chen,Q., Qian,K. and Yan,C.
TITLE Cloning of cDNAs with PDCD2(C) domain and their expressions during
apoptosis of HEK293T cells
JOURNAL Mol. Cell. Biochem. 280 (1-2), 185-191 (2005)
PUBMED 16311922
REMARK GeneRIF: To study the role of PDCD2_C domain in apoptosis, the
cDNAs of two isoforms of PDCD2 and MGC13096 were cloned. PDCD2
(NM_002598) was over expressed when endothelial cells treated with
leukotriene D4 or natural killer cells were activated by IL-2.
REFERENCE 6 (bases 1 to 2098)
AUTHORS Chistiakov,D.A., Seryogin,Y.A., Turakulov,R.I., Savost'anov,K.V.,
Titovich,E.V., Zilberman,L.I., Kuraeva,T.L., Dedov,I.I. and
Nosikov,V.V.
TITLE Evaluation of IDDM8 susceptibility locus in a Russian simplex
family data set
JOURNAL J. Autoimmun. 24 (3), 243-250 (2005)
PUBMED 15848047
REMARK GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
REFERENCE 7 (bases 1 to 2098)
AUTHORS Scarr,R.B. and Sharp,P.A.
TITLE PDCD2 is a negative regulator of HCF-1 (C1)
JOURNAL Oncogene 21 (34), 5245-5254 (2002)
PUBMED 12149646
REFERENCE 8 (bases 1 to 2098)
AUTHORS Baron,B.W., Anastasi,J., Thirman,M.J., Furukawa,Y., Fears,S.,
Kim,D.C., Simone,F., Birkenbach,M., Montag,A., Sadhu,A.,
Zeleznik-Le,N. and McKeithan,T.W.
TITLE The human programmed cell death-2 (PDCD2) gene is a target of BCL6
repression: implications for a role of BCL6 in the down-regulation
of apoptosis
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (5), 2860-2865 (2002)
PUBMED 11854457
REFERENCE 9 (bases 1 to 2098)
AUTHORS Kawakami,T., Furukawa,Y., Sudo,K., Saito,H., Takami,S.,
Takahashi,E. and Nakamura,Y.
TITLE Isolation and mapping of a human gene (PDCD2) that is highly
homologous to Rp8, a rat gene associated with programmed cell death
JOURNAL Cytogenet. Cell Genet. 71 (1), 41-43 (1995)
PUBMED 7606924
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AL031259.1 and AJ420535.1.
On Dec 10, 2010 this sequence version replaced gi:21735593.
Summary: This gene encodes a nuclear protein expressed in a variety
of tissues. Expression of this gene has been shown to be repressed
by B-cell CLL/lymphoma 6 (BCL6), a transcriptional repressor
required for lymph node germinal center development, suggesting
that BCL6 regulates apoptosis by its effects on this protein.
Alternative splicing results in multiple transcript variants and
pseudogenes have been identified on chromosomes 9 and 12. [provided
by RefSeq, Dec 2010].
Transcript Variant: This variant (2) differs in the 3' coding
region and UTR, compared to variant 1. The resulting protein
(isoform 2) has a shorter and distinct C-terminus, compared to
isoform 1.
Sequence Note: This RefSeq record was created from transcript and
genomic sequence data to make the sequence consistent with the
reference genome assembly. The genomic coordinates used for the
transcript record were based on transcript alignments.
##Evidence-Data-START##
Transcript exon combination :: AJ420535.1, BG721244.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025088, ERS025098 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-262 AL031259.1 64250-64511
263-813 AJ420535.1 9-559
814-814 AL031259.1 65930-65930
815-1057 AJ420535.1 561-803
1058-1058 AL031259.1 66174-66174
1059-1420 AJ420535.1 805-1166
1421-1421 AL031259.1 66537-66537
1422-2098 AJ420535.1 1168-1844
FEATURES Location/Qualifiers
source 1..2098
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="6"
/map="6q27"
gene 1..2098
/gene="PDCD2"
/gene_synonym="RP8; ZMYND7"
/note="programmed cell death 2"
/db_xref="GeneID:5134"
/db_xref="HGNC:8762"
/db_xref="HPRD:02922"
/db_xref="MIM:600866"
exon 1..394
/gene="PDCD2"
/gene_synonym="RP8; ZMYND7"
/inference="alignment:Splign:1.39.8"
CDS 112..798
/gene="PDCD2"
/gene_synonym="RP8; ZMYND7"
/note="isoform 2 is encoded by transcript variant 2; zinc
finger protein Rp-8; programmed cell death protein 2; zinc
finger MYND domain-containing protein 7"
/codon_start=1
/product="programmed cell death protein 2 isoform 2"
/protein_id="NP_659005.1"
/db_xref="GI:21735594"
/db_xref="CCDS:CCDS47521.1"
/db_xref="GeneID:5134"
/db_xref="HGNC:8762"
/db_xref="HPRD:02922"
/db_xref="MIM:600866"
/translation="
MAAAGARPVELGFAESAPAWRLRSEQFPSKVGGRPAWLGAAGLPGPQALACELCGRPLSFLLQVYAPLPGRPDAFHRCIFLFCCREQPCCAGLRVFRNQLPRKNDFYSYEPPSENPPPETGESVCLQLKSGAHLCRVCGCLGPKTCSRCHKAYYCSKEHQTLDWRLGHKQACAQPDHLDHIIPDHNFLFPEFEIVIETEDEIMPEVVEKEDYSEIIGSMGKQFQDFIH
"
misc_feature 514..627
/gene="PDCD2"
/gene_synonym="RP8; ZMYND7"
/note="MYND finger; Region: zf-MYND; pfam01753"
/db_xref="CDD:201954"
variation 372
/gene="PDCD2"
/gene_synonym="RP8; ZMYND7"
/replace="g"
/replace="t"
/db_xref="dbSNP:11557807"
STS 386..560
/gene="PDCD2"
/gene_synonym="RP8; ZMYND7"
/standard_name="RH40415"
/db_xref="UniSTS:89054"
exon 395..637
/gene="PDCD2"
/gene_synonym="RP8; ZMYND7"
/inference="alignment:Splign:1.39.8"
STS 529..630
/gene="PDCD2"
/gene_synonym="RP8; ZMYND7"
/standard_name="SHGC-31353"
/db_xref="UniSTS:75965"
exon 638..2079
/gene="PDCD2"
/gene_synonym="RP8; ZMYND7"
/inference="alignment:Splign:1.39.8"
variation 1058
/gene="PDCD2"
/gene_synonym="RP8; ZMYND7"
/replace="g"
/replace="t"
/db_xref="dbSNP:2072917"
variation 1421
/gene="PDCD2"
/gene_synonym="RP8; ZMYND7"
/replace="a"
/replace="c"
/db_xref="dbSNP:2066954"
STS 1764..1988
/gene="PDCD2"
/gene_synonym="RP8; ZMYND7"
/standard_name="RH39860"
/db_xref="UniSTS:91330"
STS 1824..2044
/gene="PDCD2"
/gene_synonym="RP8; ZMYND7"
/standard_name="SHGC-132283"
/db_xref="UniSTS:170760"
STS 1824..1976
/gene="PDCD2"
/gene_synonym="RP8; ZMYND7"
/standard_name="SHGC-183"
/db_xref="UniSTS:70157"
STS 1909..2042
/gene="PDCD2"
/gene_synonym="RP8; ZMYND7"
/standard_name="RH46730"
/db_xref="UniSTS:8505"
polyA_signal 2061..2066
/gene="PDCD2"
/gene_synonym="RP8; ZMYND7"
polyA_site 2079
/gene="PDCD2"
/gene_synonym="RP8; ZMYND7"
ORIGIN
tccgcctcctgtcctccggaaaggtgcccgcctcttgccttccggcccggcgcccgatttccgccttccgacccagctgtgggctgcgccccacgccagcccgcgccccgcatggctgccgccggggccaggcctgtggagctgggcttcgccgagtcggcgccggcgtggcgactgcgcagcgagcagttccccagcaaggtgggcgggcggccggcatggctgggcgcggccgggctgccggggccccaggccctggcctgcgagctgtgcggccgcccgctctccttcctgctgcaggtgtatgcgccgctgcctggccgcccggacgccttccaccgctgcatcttcctcttctgctgccgcgagcagccgtgctgtgccggcctgcgagtttttaggaatcaactacccaggaaaaacgatttttactcatatgagccaccttctgagaatcctcccccagaaacaggagaatcagtgtgtctccagcttaagtctggtgctcatctctgcagggtttgtggctgtttaggccccaaaacgtgctccagatgccacaaagcatattactgcagcaaggagcatcagaccctagactggagattgggacataagcaggcttgtgcacaaccagatcatctggaccatataattccagaccacaacttcctttttccagaatttgaaattgtaatagaaacagaagatgagattatgcctgaggttgtggaaaaggaagattactcagagattatagggagcatgggtaagcagtttcaggacttcattcattaagtggttaaacataatacttggaagaaagggctccatgtgcctagaagagaggtactgagaggaagactcactttggaggctgtagcatacaattttcagatattgcctcaggtaaaaatatacttcctggactttgttttctgacacataagaggtgtgttctgctccctgtaaagacaagggtgggtatccagatggtcccatgagtagggctgcacaagatgctggaggcttggtaagttcctctgggtcgcagatcggtttctcgggtcgggatagtgtgagtgcctagcacagtgtcgggcacgcagaagggccccttaaaagtttctctttcatctggccagttttagatacacaattttgtcagtttacttacagtgcatactcttgggtagtacttgtgctgaccaagtatcttagaggcttattttattatagtagccaacatttatccagcacttaccttatataaagggctgtttgtgcatgagctcattaaaatcgtgacagcagaccaatgagtgagaaactgccccattttgaaggtgaggaaattgaggttctgggtataactttctttggtcacataatattaaattttacaatttgagccttgagccatacacaaaaccaccacaaaattagatttatagactcaaaatgaaaacatcagcttactggtttgtagttcataccagtcatacattccaaaacatgttttgagtcttactctgtgcctgaccttgtgcttgataacagggatataatgggaagcaacactccagtggtcagatgctcacagtcttatggaggagcccaaataatatctggggaagttaaagtccatataatgactgataagagtacaatacaggtgccatgggaacacgtgacatcactgaagactgcctggaaggggccgcgcgtgtgttcatgcctatacgataaacatgatacataatgaaaatgcttatctttaggagaaaggagagcctagagtagcaggatcaaggatgaaagctggacttcaaatatgccttgttagtgtaaatgtgactgtggaactgtatgagtattttaagattatggagtaaagtaagttttaaaaagcagtccctaatcatcaaaagtaaaaaactcttgatgtagtcatataaccacactaagaactcttccaggtgacttcaaaacataggacagtacatctctagtagaatatgccctgagaatgaaaagaatgtaacagtgttagtattttgaataaacatgttattactaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:5134 -> Molecular function: GO:0003677 [DNA binding] evidence: IEA
GeneID:5134 -> Molecular function: GO:0046872 [metal ion binding] evidence: IEA
GeneID:5134 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:5134 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
GeneID:5134 -> Cellular component: GO:0005737 [cytoplasm] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.