Home |
Help |
Advanced search
2024-04-20 23:27:10, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_139323 3136 bp mRNA linear PRI 04-JUL-2013
DEFINITION Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase
activation protein, beta polypeptide (YWHAB), transcript variant 2,
mRNA.
ACCESSION NM_139323
VERSION NM_139323.3 GI:520975504
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 3136)
AUTHORS Jeong BH, Jin HT, Choi EK, Carp RI and Kim YS.
TITLE Lack of association between 14-3-3 beta gene (YWHAB) polymorphisms
and sporadic Creutzfeldt-Jakob disease (CJD)
JOURNAL Mol. Biol. Rep. 39 (12), 10647-10653 (2012)
PUBMED 23053962
REMARK GeneRIF: These results indicate that the six YWHAB polymorphisms
are not associated with the genetic susceptibility to sporadic
Creutzfeldt-Jakob disease.
REFERENCE 2 (bases 1 to 3136)
AUTHORS Liang X, Da Paula AC, Bozoky Z, Zhang H, Bertrand CA, Peters KW,
Forman-Kay JD and Frizzell RA.
TITLE Phosphorylation-dependent 14-3-3 protein interactions regulate CFTR
biogenesis
JOURNAL Mol. Biol. Cell 23 (6), 996-1009 (2012)
PUBMED 22278744
REMARK GeneRIF: 14-3-3beta binding to phosphorylated CFTR augments its
biogenesis by reducing retrograde retrieval of CFTR to the
endoplasmic reticulum. This mechanism permits cAMP/PKA stimulation
to make more CFTR available for anion secretion.
REFERENCE 3 (bases 1 to 3136)
AUTHORS Asdaghi N, Kilani RT, Hosseini-Tabatabaei A, Odemuyiwa SO, Hackett
TL, Knight DA, Ghahary A and Moqbel R.
TITLE Extracellular 14-3-3 from human lung epithelial cells enhances
MMP-1 expression
JOURNAL Mol. Cell. Biochem. 360 (1-2), 261-270 (2012)
PUBMED 21948273
REMARK GeneRIF: Modulation of matrix metalloproteinase 1 by
14-3beta/alpha, may be important in the alteration of collagenase
production associated with airway remodelling in obstructive lung
diseases
REFERENCE 4 (bases 1 to 3136)
AUTHORS Petri MK, Koch P, Stenzinger A, Kuchelmeister K, Nestler U,
Paradowska A, Steger K, Brobeil A, Viard M and Wimmer M.
TITLE PTPIP51, a positive modulator of the MAPK/Erk pathway, is
upregulated in glioblastoma and interacts with 14-3-3beta and PTP1B
in situ
JOURNAL Histol. Histopathol. 26 (12), 1531-1543 (2011)
PUBMED 21972092
REMARK GeneRIF: In glioblastoma PTPIP51 expression increases with the
grade of malignancy and PTPIP51 interacts in situ with 14-3-3ss and
PTP1B.
REFERENCE 5 (bases 1 to 3136)
AUTHORS O'Dwyer D, Ralton LD, O'Shea A and Murray GI.
TITLE The proteomics of colorectal cancer: identification of a protein
signature associated with prognosis
JOURNAL PLoS ONE 6 (11), E27718 (2011)
PUBMED 22125622
REMARK GeneRIF: Data identified 14-3-3beta as a prognostic biomarker.
REFERENCE 6 (bases 1 to 3136)
AUTHORS Tommerup N and Leffers H.
TITLE Assignment of the human genes encoding 14,3-3 Eta (YWHAH) to 22q12,
14-3-3 zeta (YWHAZ) to 2p25.1-p25.2, and 14-3-3 beta (YWHAB) to
20q13.1 by in situ hybridization
JOURNAL Genomics 33 (1), 149-150 (1996)
PUBMED 8617504
REFERENCE 7 (bases 1 to 3136)
AUTHORS Conklin DS, Galaktionov K and Beach D.
TITLE 14-3-3 proteins associate with cdc25 phosphatases
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 92 (17), 7892-7896 (1995)
PUBMED 7644510
REFERENCE 8 (bases 1 to 3136)
AUTHORS Aitken A, Howell S, Jones D, Madrazo J and Patel Y.
TITLE 14-3-3 alpha and delta are the phosphorylated forms of
raf-activating 14-3-3 beta and zeta. In vivo stoichiometric
phosphorylation in brain at a Ser-Pro-Glu-Lys MOTIF
JOURNAL J. Biol. Chem. 270 (11), 5706-5709 (1995)
PUBMED 7890696
REFERENCE 9 (bases 1 to 3136)
AUTHORS Roth D, Morgan A, Martin H, Jones D, Martens GJ, Aitken A and
Burgoyne RD.
TITLE Characterization of 14-3-3 proteins in adrenal chromaffin cells and
demonstration of isoform-specific phospholipid binding
JOURNAL Biochem. J. 301 (PT 1), 305-310 (1994)
PUBMED 8037685
REFERENCE 10 (bases 1 to 3136)
AUTHORS Leffers H, Madsen P, Rasmussen HH, Honore B, Andersen AH, Walbum E,
Vandekerckhove J and Celis JE.
TITLE Molecular cloning and expression of the transformation sensitive
epithelial marker stratifin. A member of a protein family that has
been involved in the protein kinase C signalling pathway
JOURNAL J. Mol. Biol. 231 (4), 982-998 (1993)
PUBMED 8515476
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DB443535.1, BC001359.2,
AL008725.1 and AA845374.1.
On Jul 4, 2013 this sequence version replaced gi:31742480.
Summary: This gene encodes a protein belonging to the 14-3-3 family
of proteins, members of which mediate signal transduction by
binding to phosphoserine-containing proteins. This highly conserved
protein family is found in both plants and mammals. The encoded
protein has been shown to interact with RAF1 and CDC25
phosphatases, suggesting that it may play a role in linking
mitogenic signaling and the cell cycle machinery. Two transcript
variants, which encode the same protein, have been identified for
this gene. [provided by RefSeq, Jul 2008].
Transcript Variant: This variant (2) lacks an exon in the 5' UTR
compared to variant 1. Variants 1 and 2 both encode the same
protein.
Sequence Note: This RefSeq record was created from transcript and
genomic sequence data to make the sequence consistent with the
reference genome assembly. The genomic coordinates used for the
transcript record were based on transcript alignments.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AL834170.1, AL513636.3 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-110 DB443535.1 55-164
111-1116 BC001359.2 1-1006
1117-2643 AL008725.1 61652-63178
2644-3136 AA845374.1 1-493 c
FEATURES Location/Qualifiers
source 1..3136
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="20"
/map="20q13.1"
gene 1..3136
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/note="tyrosine 3-monooxygenase/tryptophan 5-monooxygenase
activation protein, beta polypeptide"
/db_xref="GeneID:7529"
/db_xref="HGNC:12849"
/db_xref="HPRD:03184"
/db_xref="MIM:601289"
exon 1..288
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/inference="alignment:Splign:1.39.8"
exon 289..591
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/inference="alignment:Splign:1.39.8"
CDS 292..1032
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/note="tyrosine 3-monooxygenase/tryptophan 5-monooxygenase
activation protein, alpha polypeptide; 14-3-3 alpha;
protein kinase C inhibitor protein-1; protein 1054; brain
protein 14-3-3, beta isoform; protein kinase C inhibitor
protein 1"
/codon_start=1
/product="14-3-3 protein beta/alpha"
/protein_id="NP_647539.1"
/db_xref="GI:21328448"
/db_xref="CCDS:CCDS13339.1"
/db_xref="GeneID:7529"
/db_xref="HGNC:12849"
/db_xref="HPRD:03184"
/db_xref="MIM:601289"
/translation="
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
"
misc_feature 292..294
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/experiment="experimental evidence, no additional details
recorded"
/note="N-acetylmethionine, in 14-3-3 protein beta/alpha,
alternate; propagated from UniProtKB/Swiss-Prot
(P31946.3); acetylation site"
misc_feature 295..297
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/experiment="experimental evidence, no additional details
recorded"
/note="N-acetylthreonine, in 14-3-3 protein beta/alpha,
N-terminally processed; propagated from
UniProtKB/Swiss-Prot (P31946.3); acetylation site"
misc_feature 301..987
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/note="14-3-3 beta and zeta isoforms of 14-3-3 protein;
Region: 14-3-3_beta_zeta; cd10022"
/db_xref="CDD:206758"
misc_feature order(310..312,319..324,331..336,340..345,349..351,
358..360,469..471,478..480,490..492,520..522,529..534,
541..543,550..555,562..564)
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/note="dimer interface [polypeptide binding]; other site"
/db_xref="CDD:206758"
misc_feature order(418..423,430..435,442..444,646..648,655..657,
676..681,790..792,802..804,811..816,823..825,922..936,
943..948,955..957,967..969)
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/note="peptide binding site [polypeptide binding]; other
site"
/db_xref="CDD:206758"
misc_feature 463..465
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/inference="non-experimental evidence, no additional
details recorded"
/note="Interaction with phosphoserine on interacting
protein (By similarity); propagated from
UniProtKB/Swiss-Prot (P31946.3); other site"
misc_feature 469..471
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 499..501
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P31946.3); acetylation site"
misc_feature 640..642
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P31946.3); acetylation site"
misc_feature 676..678
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/inference="non-experimental evidence, no additional
details recorded"
/note="Interaction with phosphoserine on interacting
protein (By similarity); propagated from
UniProtKB/Swiss-Prot (P31946.3); other site"
misc_feature 685..687
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:01504"
misc_feature 718..720
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:01504"
misc_feature 847..849
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/citation=[8]
exon 592..715
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/inference="alignment:Splign:1.39.8"
exon 716..879
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/inference="alignment:Splign:1.39.8"
STS 728..884
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/standard_name="STS-N23075"
/db_xref="UniSTS:6129"
STS 837..973
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/standard_name="STS-X57346"
/db_xref="UniSTS:46319"
exon 880..975
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/inference="alignment:Splign:1.39.8"
STS 967..1155
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/standard_name="RH66089"
/db_xref="UniSTS:89219"
exon 976..3126
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/inference="alignment:Splign:1.39.8"
STS 1210..1340
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/standard_name="SHGC-37252"
/db_xref="UniSTS:16827"
STS 1375..2092
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/standard_name="YWHAB__v346"
/db_xref="UniSTS:277869"
STS 1827..1930
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/standard_name="D20S586E"
/db_xref="UniSTS:48879"
STS 1911..2013
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/standard_name="D20S556E"
/db_xref="UniSTS:88619"
STS 2858..2962
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
/standard_name="D20S528E"
/db_xref="UniSTS:150763"
polyA_signal 3095..3100
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
polyA_site 3126
/gene="YWHAB"
/gene_synonym="GW128; HS1; KCIP-1; YWHAA"
ORIGIN
gcgcccctcccgtggggccgtggcaaccccgtgcctcgcttgcccaatgagaacacggtttggggcggggcgcggccaggaccggagcggaagtggcgatcggagcggaagtggagctaccgccaccgccgccgccgattccggagccggggtagtcgccgccgccgccgccgctgcagccactgcaggcaccgctgccgccgcctgagtagtgggcttaggaaggaagaggtcatctcgctcggagcttcgctcggaagggtctttgttccctgcagccctcccacgggaatgacaatggataaaagtgagctggtacagaaagccaaactcgctgagcaggctgagcgatatgatgatatggctgcagccatgaaggcagtcacagaacaggggcatgaactctccaacgaagagagaaatctgctctctgttgcctacaagaatgtggtaggcgcccgccgctcttcctggcgtgtcatctccagcattgagcagaaaacagagaggaatgagaagaagcagcagatgggcaaagagtaccgtgagaagatagaggcagaactgcaggacatctgcaatgatgttctggagctgttggacaaatatcttattcccaatgctacacaaccagaaagtaaggtgttctacttgaaaatgaaaggagattattttaggtatctttctgaagtggcatctggagacaacaaacaaaccactgtgtcgaactcccagcaggcttaccaggaagcatttgaaattagtaagaaagaaatgcagcctacacacccaattcgtcttggtctggcactaaatttctcagtcttttactatgagattctaaactctcctgaaaaggcctgtagcctggcaaaaacggcatttgatgaagcaattgctgaattggatacgctgaatgaagagtcttataaagacagcactctgatcatgcagttacttagggacaatctcactctgtggacatcggaaaaccagggagacgaaggagacgctggggagggagagaactaatgtttctcgtgctttgtgatctgttcagtgtcactctgtaccctcaacatatatcccttgtgcgataaaaaaaaaaaaaaaaaaaaaaagagaatcgtacgtcgactttcgatttttcacagcctcagcctaggaaaaatggttcatgggataaacagctggtatttgtatctaaaactcagattggtcacataaatgccacggcattccgaagttttgattttgattaacattgacaggattactgtgtgtttaattttttaaaaactgaacactgtgattatggggttttgtaatttagcagaactcttactggtagaaaaaatagacctgaattatgtgtaactttttggaaggtttaatctgatatcaaaataatcattgaaatacaattccattgtaaagttgtacagaaagttatagagattatattgtgatgctggaacttggagtgagacacacatcatttggcatttgagttgaatggtaattcacagtaatgctgccgttgttcgggacttaaagacacttgacctgtttgggctgttgccacttaaaagttcatgaccacaaatgtccacagtgtcttcctctgaggaaactcgaatcctgaaatggaaattctttgtggcagataactggcttatgacaccttgaaaagttcaagtgctcatataacacaccacactgaaccccctttcctacagcaatatgttcactatgttaccaatttgcaacttgtgcttcaatagtggaatctactttcattgttaacactgagctaaagaaaaaaagccgtgtgttttatgaatgaccttatctgtttcctggataatacctttaagaataatgtcctgagtcaggcgtggtggtgcgtgcatctagtcccaactatttgggaggctgaggcaggaggatcgcttgagcccaggagtttaaagctgcagtgccctgtggttgcacctgtgaataactgcactccagcctgggcaacatagcgagacctcatctccaaaaaagaaaacaaaaaacaaaaaaaggaatgatgttctgtagagatggcctttcacttgaggagtactcagttttcaggttcttcctagctcggggcttttaaattttgaaatctaaacattctttcccaccatcctttttgactgttgaccttggttttctcttctaagtttctgtccctctgcttccttactttttttcctttttgaattctatctttatctgtcttttgttcactttttaatgctatatatgggcaggggtgagagacattactgagcaccttggtgagcaagcctggctttaaagattggagaagagcttctggcaccagaaccctgtcttcctccagttctcaacacggtgttgctcttcagtcataccggaatctgaatcaaaaaagtatttttaaatatccatgatttctccctgtattgaggctagccctgatcatgctttttgtgcctgtcaccaggtctcccaagtgcactcatccaggtcagtgctcagatgtgtttaaggagaccctatattcagggaagttgcgtgaacactgcagtggggagaattgagaatagtcaggcctatcagtctcacagaatcacccctctacctttgatattccacttagctgtagagtccatctgtttgtccatctgctgaaatgagaaaagaaaaatttatgcactgatttaaaacaaaccaaaaaaaaagaaaaaaacaaaaaaaaaaatccctcctttctagctgaacaaaaatgtgcagttaatacttggcgcttgaaaatgcagtagtgaatgtggaaccaagcctgtctgtatatctggtagctcttttcttgctttgttttttcttaccagtattctgcctaacgtttgcttctgtgatggttatattgcctagcaagcacacccgtggttgtgaaaatagtatagcaaaaaagaaaaatccccggttattgatgtactagatttgtgtatgtcttttaaacagttctagtttcaccttacacagaataatcaggaaaagtgtaaaaattcaaaagtgaaataaaaattttatcagttagttgcctgtgaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:7529 -> Molecular function: GO:0003714 [transcription corepressor activity] evidence: IEA
GeneID:7529 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:7529 -> Molecular function: GO:0008022 [protein C-terminus binding] evidence: IEA
GeneID:7529 -> Molecular function: GO:0019899 [enzyme binding] evidence: IPI
GeneID:7529 -> Molecular function: GO:0019904 [protein domain specific binding] evidence: IPI
GeneID:7529 -> Molecular function: GO:0032403 [protein complex binding] evidence: IEA
GeneID:7529 -> Molecular function: GO:0042826 [histone deacetylase binding] evidence: IPI
GeneID:7529 -> Molecular function: GO:0050815 [phosphoserine binding] evidence: IPI
GeneID:7529 -> Molecular function: GO:0051219 [phosphoprotein binding] evidence: IPI
GeneID:7529 -> Biological process: GO:0000165 [MAPK cascade] evidence: TAS
GeneID:7529 -> Biological process: GO:0000186 [activation of MAPKK activity] evidence: TAS
GeneID:7529 -> Biological process: GO:0006605 [protein targeting] evidence: IEA
GeneID:7529 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:7529 -> Biological process: GO:0007173 [epidermal growth factor receptor signaling pathway] evidence: TAS
GeneID:7529 -> Biological process: GO:0007264 [small GTPase mediated signal transduction] evidence: TAS
GeneID:7529 -> Biological process: GO:0007265 [Ras protein signal transduction] evidence: TAS
GeneID:7529 -> Biological process: GO:0007411 [axon guidance] evidence: TAS
GeneID:7529 -> Biological process: GO:0008286 [insulin receptor signaling pathway] evidence: TAS
GeneID:7529 -> Biological process: GO:0008543 [fibroblast growth factor receptor signaling pathway] evidence: TAS
GeneID:7529 -> Biological process: GO:0010467 [gene expression] evidence: TAS
GeneID:7529 -> Biological process: GO:0016044 [cellular membrane organization] evidence: TAS
GeneID:7529 -> Biological process: GO:0016070 [RNA metabolic process] evidence: TAS
GeneID:7529 -> Biological process: GO:0016071 [mRNA metabolic process] evidence: TAS
GeneID:7529 -> Biological process: GO:0035308 [negative regulation of protein dephosphorylation] evidence: IDA
GeneID:7529 -> Biological process: GO:0035329 [hippo signaling cascade] evidence: TAS
GeneID:7529 -> Biological process: GO:0038095 [Fc-epsilon receptor signaling pathway] evidence: TAS
GeneID:7529 -> Biological process: GO:0043085 [positive regulation of catalytic activity] evidence: IDA
GeneID:7529 -> Biological process: GO:0045087 [innate immune response] evidence: TAS
GeneID:7529 -> Biological process: GO:0045892 [negative regulation of transcription, DNA-dependent] evidence: IEA
GeneID:7529 -> Biological process: GO:0048011 [neurotrophin TRK receptor signaling pathway] evidence: TAS
GeneID:7529 -> Biological process: GO:0051220 [cytoplasmic sequestering of protein] evidence: IDA
GeneID:7529 -> Biological process: GO:0051291 [protein heterooligomerization] evidence: IEA
GeneID:7529 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: TAS
GeneID:7529 -> Biological process: GO:1900740 [positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway] evidence: TAS
GeneID:7529 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:7529 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:7529 -> Cellular component: GO:0017053 [transcriptional repressor complex] evidence: IEA
GeneID:7529 -> Cellular component: GO:0030659 [cytoplasmic vesicle membrane] evidence: TAS
GeneID:7529 -> Cellular component: GO:0042470 [melanosome] evidence: IEA
GeneID:7529 -> Cellular component: GO:0048471 [perinuclear region of cytoplasm] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.