2024-04-20 11:32:10, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_139214 880 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens TGFB-induced factor homeobox 2-like, Y-linked (TGIF2LY), mRNA. ACCESSION NM_139214 VERSION NM_139214.2 GI:34328942 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 880) AUTHORS Ousati Ashtiani,Z., Ayati,M., Modarresi,M.H., Raoofian,R., Sabah Goulian,B., Greene,W.K. and Heidari,M. TITLE Association of TGIFLX/Y mRNA expression with prostate cancer JOURNAL Med. Oncol. 26 (1), 73-77 (2009) PUBMED 18663611 REMARK GeneRIF: most prostate tumors (73.5%) express at least one of these genes (TGIFLX and TGIFLY), although different patterns of mRNA expression were observed. These results suggest an association of TGIFLX/Y expression with the progression of prostate cancer. REFERENCE 2 (bases 1 to 880) AUTHORS Aarabi,M., Ousati-Ashtiani,Z., Nazarian,A., Modarressi,M.H. and Heidari,M. TITLE Association of TGIFLX/Y mRNA expression with azoospermia in infertile men JOURNAL Mol. Reprod. Dev. 75 (12), 1761-1766 (2008) PUBMED 18384077 REMARK GeneRIF: Association of TGIFLX/Y mRNA expression with azoospermia in infertile men.( REFERENCE 3 (bases 1 to 880) AUTHORS Skaletsky,H., Kuroda-Kawaguchi,T., Minx,P.J., Cordum,H.S., Hillier,L., Brown,L.G., Repping,S., Pyntikova,T., Ali,J., Bieri,T., Chinwalla,A., Delehaunty,A., Delehaunty,K., Du,H., Fewell,G., Fulton,L., Fulton,R., Graves,T., Hou,S.F., Latrielle,P., Leonard,S., Mardis,E., Maupin,R., McPherson,J., Miner,T., Nash,W., Nguyen,C., Ozersky,P., Pepin,K., Rock,S., Rohlfing,T., Scott,K., Schultz,B., Strong,C., Tin-Wollam,A., Yang,S.P., Waterston,R.H., Wilson,R.K., Rozen,S. and Page,D.C. TITLE The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes JOURNAL Nature 423 (6942), 825-837 (2003) PUBMED 12815422 REFERENCE 4 (bases 1 to 880) AUTHORS Blanco-Arias,P., Sargent,C.A. and Affara,N.A. TITLE The human-specific Yp11.2/Xq21.3 homology block encodes a potentially functional testis-specific TGIF-like retroposon JOURNAL Mamm. Genome 13 (8), 463-468 (2002) PUBMED 12226713 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AF332223.1. On Aug 28, 2003 this sequence version replaced gi:21245107. Summary: This gene encodes a member of the TALE/TGIF homeobox family of transcription factors. This gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition. The C-terminus of this protein is divergent from that of its chromosome X homolog (TGIF2LX), suggesting that this protein may act as a regulator of TGIF2LX. [provided by RefSeq, Jul 2008]. ##Evidence-Data-START## Transcript exon combination :: AF332223.1, AK292609.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084, ERS025085 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. FEATURES Location/Qualifiers source 1..880 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="Y" /map="Yp11.2" gene 1..880 /gene="TGIF2LY" /gene_synonym="TGIFLY" /note="TGFB-induced factor homeobox 2-like, Y-linked" /db_xref="GeneID:90655" /db_xref="HGNC:18569" /db_xref="HPRD:18512" /db_xref="MIM:400025" exon 1..43 /gene="TGIF2LY" /gene_synonym="TGIFLY" /inference="alignment:Splign:1.39.8" STS 16..812 /gene="TGIF2LY" /gene_synonym="TGIFLY" /db_xref="UniSTS:486389" STS 31..732 /gene="TGIF2LY" /gene_synonym="TGIFLY" /db_xref="UniSTS:482950" exon 44..861 /gene="TGIF2LY" /gene_synonym="TGIFLY" /inference="alignment:Splign:1.39.8" misc_feature 50..52 /gene="TGIF2LY" /gene_synonym="TGIFLY" /note="upstream in-frame stop codon" CDS 65..622 /gene="TGIF2LY" /gene_synonym="TGIFLY" /note="TGFB-induced factor 2-like, Y-linked; TGIF-like on the Y; TGFB-induced factor 2-like protein, Y-linked; TGF-beta-induced transcription factor 2-like protein" /codon_start=1 /product="homeobox protein TGIF2LY" /protein_id="NP_631960.1" /db_xref="GI:21245108" /db_xref="CCDS:CCDS14775.1" /db_xref="GeneID:90655" /db_xref="HGNC:18569" /db_xref="HPRD:18512" /db_xref="MIM:400025" /translation="
MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLRISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGPVVQTMYKACPCGPCQRARCQERSNQIRSRPLARSSPE
" misc_feature 215..385 /gene="TGIF2LY" /gene_synonym="TGIFLY" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:28970" misc_feature order(215..229,233..235,293..295,311..313,350..352, 356..361,368..373,377..385) /gene="TGIF2LY" /gene_synonym="TGIFLY" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:28970" misc_feature order(221..223,230..232,359..361,368..373,380..382) /gene="TGIF2LY" /gene_synonym="TGIFLY" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:28970" variation 79 /gene="TGIF2LY" /gene_synonym="TGIFLY" /replace="a" /replace="g" /db_xref="dbSNP:78066186" variation 88 /gene="TGIF2LY" /gene_synonym="TGIFLY" /replace="a" /replace="g" /db_xref="dbSNP:375238037" variation 127 /gene="TGIF2LY" /gene_synonym="TGIFLY" /replace="a" /replace="g" /db_xref="dbSNP:369861650" variation 177 /gene="TGIF2LY" /gene_synonym="TGIFLY" /replace="c" /replace="t" /db_xref="dbSNP:371942276" variation 285 /gene="TGIF2LY" /gene_synonym="TGIFLY" /replace="a" /replace="t" /db_xref="dbSNP:376345032" STS 331..711 /gene="TGIF2LY" /gene_synonym="TGIFLY" /standard_name="sY1254" /db_xref="UniSTS:259321" variation 383 /gene="TGIF2LY" /gene_synonym="TGIFLY" /replace="c" /replace="t" /db_xref="dbSNP:367841917" variation 525 /gene="TGIF2LY" /gene_synonym="TGIFLY" /replace="a" /replace="c" /db_xref="dbSNP:370000054" variation 533 /gene="TGIF2LY" /gene_synonym="TGIFLY" /replace="g" /replace="t" /db_xref="dbSNP:201108862" variation 587 /gene="TGIF2LY" /gene_synonym="TGIFLY" /replace="c" /replace="t" /db_xref="dbSNP:377412222" variation 605 /gene="TGIF2LY" /gene_synonym="TGIFLY" /replace="a" /replace="g" /db_xref="dbSNP:201753203" variation 630 /gene="TGIF2LY" /gene_synonym="TGIFLY" /replace="a" /replace="g" /db_xref="dbSNP:1053786" variation 646 /gene="TGIF2LY" /gene_synonym="TGIFLY" /replace="a" /replace="g" /db_xref="dbSNP:1053787" variation 657 /gene="TGIF2LY" /gene_synonym="TGIFLY" /replace="a" /replace="t" /db_xref="dbSNP:1053788" variation 694 /gene="TGIF2LY" /gene_synonym="TGIFLY" /replace="c" /replace="t" /db_xref="dbSNP:1053790" variation 743 /gene="TGIF2LY" /gene_synonym="TGIFLY" /replace="c" /replace="g" /db_xref="dbSNP:1053791" polyA_site 861 /gene="TGIF2LY" /gene_synonym="TGIFLY" ORIGIN
caactctgttagcaaagctgtttgtctttctcggaaacaacagtaacgataagcctctttgaatatggaggccgctgcagacggcccggctgagacccaaagcccggtggaaaaagacagcccggcgaagacccaaagcccagcccaagacacctcaatcatgtcgagaaataacgcagatacaggcagagttcttgccttaccagagcacaagaagaagcgcaagggaaacttgccagccgagtccgttaagatcctccgcgactggatgtataagcatcggtttaaggcctacccttcagaagaagagaagcaaatgctgtcagagaagaccaatttgtctttgttgcggatttctaactggtttatcaatgctcgcagacgcattctcccggatatgcttcaacagcgtagaaacgaccccatcattggccacaaaacgggcaaagatgcccatgccacccacctgcagagcaccgaggcgtctgtgccggccaagtcagggccagtggtccagacaatgtacaaagcctgcccctgtggcccttgccaaagggccagatgtcaagagagaagcaaccagatccggagtcggcccctagccagaagctcaccggaatagcccagccaaagaaaaaggtcaagatttctatcacttccccgtcttctccagaacttgtgtctccagaggagtacgccgacttcagcagcttcctgctgctagtcgatgcagcagtacaaacggctgccgagctggagctagagaagaagcaagagcctaatccatgattgatgatgttccaaaaacccaagtagtcagtcccttgtgtactgtggtaaacctgtttatgttcaccccaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:90655 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA GeneID:90655 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA GeneID:90655 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA GeneID:90655 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.