LOCUS       NM_139214                880 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens TGFB-induced factor homeobox 2-like, Y-linked
            (TGIF2LY), mRNA.
ACCESSION   NM_139214
VERSION     NM_139214.2  GI:34328942
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 880)
  AUTHORS   Ousati Ashtiani,Z., Ayati,M., Modarresi,M.H., Raoofian,R., Sabah
            Goulian,B., Greene,W.K. and Heidari,M.
  TITLE     Association of TGIFLX/Y mRNA expression with prostate cancer
  JOURNAL   Med. Oncol. 26 (1), 73-77 (2009)
   PUBMED   18663611
  REMARK    GeneRIF: most prostate tumors (73.5%) express at least one of these
            genes (TGIFLX and TGIFLY), although different patterns of mRNA
            expression were observed. These results suggest an association of
            TGIFLX/Y expression with the progression of prostate cancer.
REFERENCE   2  (bases 1 to 880)
  AUTHORS   Aarabi,M., Ousati-Ashtiani,Z., Nazarian,A., Modarressi,M.H. and
            Heidari,M.
  TITLE     Association of TGIFLX/Y mRNA expression with azoospermia in
            infertile men
  JOURNAL   Mol. Reprod. Dev. 75 (12), 1761-1766 (2008)
   PUBMED   18384077
  REMARK    GeneRIF: Association of TGIFLX/Y mRNA expression with azoospermia
            in infertile men.(
REFERENCE   3  (bases 1 to 880)
  AUTHORS   Skaletsky,H., Kuroda-Kawaguchi,T., Minx,P.J., Cordum,H.S.,
            Hillier,L., Brown,L.G., Repping,S., Pyntikova,T., Ali,J., Bieri,T.,
            Chinwalla,A., Delehaunty,A., Delehaunty,K., Du,H., Fewell,G.,
            Fulton,L., Fulton,R., Graves,T., Hou,S.F., Latrielle,P.,
            Leonard,S., Mardis,E., Maupin,R., McPherson,J., Miner,T., Nash,W.,
            Nguyen,C., Ozersky,P., Pepin,K., Rock,S., Rohlfing,T., Scott,K.,
            Schultz,B., Strong,C., Tin-Wollam,A., Yang,S.P., Waterston,R.H.,
            Wilson,R.K., Rozen,S. and Page,D.C.
  TITLE     The male-specific region of the human Y chromosome is a mosaic of
            discrete sequence classes
  JOURNAL   Nature 423 (6942), 825-837 (2003)
   PUBMED   12815422
REFERENCE   4  (bases 1 to 880)
  AUTHORS   Blanco-Arias,P., Sargent,C.A. and Affara,N.A.
  TITLE     The human-specific Yp11.2/Xq21.3 homology block encodes a
            potentially functional testis-specific TGIF-like retroposon
  JOURNAL   Mamm. Genome 13 (8), 463-468 (2002)
   PUBMED   12226713
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AF332223.1.
            On Aug 28, 2003 this sequence version replaced gi:21245107.
            
            Summary: This gene encodes a member of the TALE/TGIF homeobox
            family of transcription factors. This gene lies within the male
            specific region of chromosome Y, in a block of sequence that is
            thought to be the result of a large X-to-Y transposition. The
            C-terminus of this protein is divergent from that of its chromosome
            X homolog (TGIF2LX), suggesting that this protein may act as a
            regulator of TGIF2LX. [provided by RefSeq, Jul 2008].
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF332223.1, AK292609.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084, ERS025085 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..880
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="Y"
                     /map="Yp11.2"
     gene            1..880
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /note="TGFB-induced factor homeobox 2-like, Y-linked"
                     /db_xref="GeneID:90655"
                     /db_xref="HGNC:18569"
                     /db_xref="HPRD:18512"
                     /db_xref="MIM:400025"
     exon            1..43
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /inference="alignment:Splign:1.39.8"
     STS             16..812
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /db_xref="UniSTS:486389"
     STS             31..732
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /db_xref="UniSTS:482950"
     exon            44..861
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    50..52
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /note="upstream in-frame stop codon"
     CDS             65..622
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /note="TGFB-induced factor 2-like, Y-linked; TGIF-like on
                     the Y; TGFB-induced factor 2-like protein, Y-linked;
                     TGF-beta-induced transcription factor 2-like protein"
                     /codon_start=1
                     /product="homeobox protein TGIF2LY"
                     /protein_id="NP_631960.1"
                     /db_xref="GI:21245108"
                     /db_xref="CCDS:CCDS14775.1"
                     /db_xref="GeneID:90655"
                     /db_xref="HGNC:18569"
                     /db_xref="HPRD:18512"
                     /db_xref="MIM:400025"
                     /translation="

MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLRISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGPVVQTMYKACPCGPCQRARCQERSNQIRSRPLARSSPE

"
     misc_feature    215..385
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(215..229,233..235,293..295,311..313,350..352,
                     356..361,368..373,377..385)
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(221..223,230..232,359..361,368..373,380..382)
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     variation       79
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:78066186"
     variation       88
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375238037"
     variation       127
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369861650"
     variation       177
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371942276"
     variation       285
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:376345032"
     STS             331..711
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /standard_name="sY1254"
                     /db_xref="UniSTS:259321"
     variation       383
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367841917"
     variation       525
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:370000054"
     variation       533
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201108862"
     variation       587
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377412222"
     variation       605
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201753203"
     variation       630
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1053786"
     variation       646
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1053787"
     variation       657
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1053788"
     variation       694
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1053790"
     variation       743
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1053791"
     polyA_site      861
                     /gene="TGIF2LY"
                     /gene_synonym="TGIFLY"
ORIGIN      

caactctgttagcaaagctgtttgtctttctcggaaacaacagtaacgataagcctctttgaatatggaggccgctgcagacggcccggctgagacccaaagcccggtggaaaaagacagcccggcgaagacccaaagcccagcccaagacacctcaatcatgtcgagaaataacgcagatacaggcagagttcttgccttaccagagcacaagaagaagcgcaagggaaacttgccagccgagtccgttaagatcctccgcgactggatgtataagcatcggtttaaggcctacccttcagaagaagagaagcaaatgctgtcagagaagaccaatttgtctttgttgcggatttctaactggtttatcaatgctcgcagacgcattctcccggatatgcttcaacagcgtagaaacgaccccatcattggccacaaaacgggcaaagatgcccatgccacccacctgcagagcaccgaggcgtctgtgccggccaagtcagggccagtggtccagacaatgtacaaagcctgcccctgtggcccttgccaaagggccagatgtcaagagagaagcaaccagatccggagtcggcccctagccagaagctcaccggaatagcccagccaaagaaaaaggtcaagatttctatcacttccccgtcttctccagaacttgtgtctccagaggagtacgccgacttcagcagcttcctgctgctagtcgatgcagcagtacaaacggctgccgagctggagctagagaagaagcaagagcctaatccatgattgatgatgttccaaaaacccaagtagtcagtcccttgtgtactgtggtaaacctgtttatgttcaccccaaaaaaaaaaaaaaaaaaaaa

//

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:90655 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:90655 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
            GeneID:90655 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
            GeneID:90655 -> Cellular component: GO:0005634 [nucleus] evidence: IEA