GGRNA Home | Help | Advanced search

2020-10-26 19:52:13, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_139160               2013 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens DEP domain containing 7 (DEPDC7), transcript variant
            2, mRNA.
ACCESSION   NM_139160
VERSION     NM_139160.2  GI:116256343
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2013)
  AUTHORS   Gawin,B., Niederfuhr,A., Schumacher,N., Hummerich,H., Little,P.F.
            and Gessler,M.
  TITLE     A 7.5 Mb sequence-ready PAC contig and gene expression map of human
            chromosome 11p13-p14.1
  JOURNAL   Genome Res. 9 (11), 1074-1086 (1999)
   PUBMED   10568747
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC107939.5, AJ245600.1 and BC030970.1.
            On Oct 17, 2006 this sequence version replaced gi:21040238.
            
            Transcript Variant: This variant (2) includes a different segment
            for the 5' UTR and 5' CDS, compared to variant 1. The resulting
            protein (isoform 2) has a shorter and distinct N-terminus when it
            is compared to isoform 1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF447588.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084, ERS025085 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-404               AC107939.5         43101-43504         c
            405-1113            AJ245600.1         121-829
            1114-1673           BC030970.1         875-1434
            1674-2013           AJ245600.1         1390-1729
FEATURES             Location/Qualifiers
     source          1..2013
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="11"
                     /map="11p13"
     gene            1..2013
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /note="DEP domain containing 7"
                     /db_xref="GeneID:91614"
                     /db_xref="HGNC:29899"
                     /db_xref="MIM:612294"
     exon            1..404
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    137..139
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /note="upstream in-frame stop codon"
     variation       173
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111791472"
     variation       324
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:371138729"
     variation       329
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374778072"
     variation       345
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:367845306"
     CDS             359..1867
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /note="isoform 2 is encoded by transcript variant 2; DEP
                     domain-containing protein 7; novel 58.3 KDA protein;
                     dJ85M6.4 (novel 58.3 KDA protein)"
                     /codon_start=1
                     /product="DEP domain-containing protein 7 isoform 2"
                     /protein_id="NP_631899.2"
                     /db_xref="GI:116256344"
                     /db_xref="CCDS:CCDS41633.1"
                     /db_xref="GeneID:91614"
                     /db_xref="HGNC:29899"
                     /db_xref="MIM:612294"
                     /translation="
MRGLCEFYWQEFGIKGFSVAQKPFGATYVWSSIINTLQTQVEVKKRRHRLKRHNDCFVGSEAVDVIFSHLIQNKYFGDVDIPRAKVVRVCQALMDYKVFEAVPTKVFGKDKKPTFEDSSCSLYRFTTIPNQDSQLGKENKLYSPARYADALFKSSDIRSASLEDLWENLSLKPANSPHVNISATLSPQVINEVWQEETIGRLLQLVDLPLLDSLLKQQEAVPKIPQPKRQSTMVNSSNYLDRGILKAYSDSQEDEWLSAAIDCLEYLPDQMVVEISRSFPEQPDRTDLVKELLFDAIGRYYSSREPLLNHLSDVHNGIAELLVNGKTEIALEATQLLLKLLDFQNREEFRRLLYFMAVAANPSEFKLQKESDNRMVVKRIFSKAIVDNKNLSKGKTDLLVLFLMDHQKDVFKIPGTLHKIVSVKLMAIQNGRDPNRDAGYIYCQRIDQRDYSNNTEKTTKDELLNLLKTLDEDSKLSAKEKKKLLGQFYKCHPDIFIEHFGD
"
     misc_feature    446..730
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /note="DEP (Dishevelled, Egl-10, and Pleckstrin) domain
                     found in DEPDC4-like proteins. DEPDC4 is a DEP domain
                     containing protein of unknown function; Region:
                     DEP_DEPDC4; cd04446"
                     /db_xref="CDD:80329"
     misc_feature    911..1612
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /note="RhoGAP_BRCC3-like: RhoGAP (GTPase-activator protein
                     [GAP] for Rho-like small GTPases) domain of BRCC3-like
                     proteins. This subgroup also contains two groups of
                     closely related proteins, BRCC3 and DEPDC7, which both
                     contain a C-terminal RhoGAP-like domain...; Region:
                     RhoGAP_BRCC3-like; cd04405"
                     /db_xref="CDD:63874"
     misc_feature    order(1094..1096,1250..1252,1262..1264,1472..1474,
                     1481..1486,1547..1549)
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /note="putative GTPase interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:63874"
     misc_feature    1094..1096
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:63874"
     variation       379
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200779852"
     exon            405..795
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /inference="alignment:Splign:1.39.8"
     variation       412
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375593314"
     variation       437
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368794067"
     variation       443
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79199473"
     variation       470
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200073795"
     variation       503
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374733737"
     variation       509
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:369053359"
     variation       513
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200057806"
     variation       528
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:138325318"
     variation       568
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:74559182"
     variation       619
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369355382"
     variation       633
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372513278"
     variation       702
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376814687"
     variation       711
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371496330"
     variation       721
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202173561"
     variation       782
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374632275"
     exon            796..923
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /inference="alignment:Splign:1.39.8"
     variation       823
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367903882"
     variation       863
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200200424"
     variation       877
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:17852860"
     variation       882
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200498367"
     variation       905
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:34161108"
     exon            924..1113
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /inference="alignment:Splign:1.39.8"
     variation       927
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144655252"
     variation       942
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:375290990"
     variation       960
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201784282"
     variation       964
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371231815"
     variation       1021
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190343171"
     variation       1031
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374772959"
     variation       1043
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199885269"
     variation       1044
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148509454"
     variation       1082
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373000064"
     variation       1094
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:201199439"
     variation       1109
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:369472957"
     exon            1114..1325
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /inference="alignment:Splign:1.39.8"
     variation       1180
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:202124209"
     STS             1191..1318
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /standard_name="AB070065"
                     /db_xref="UniSTS:480067"
     variation       1195
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:36077875"
     variation       1212
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370729400"
     variation       1226
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:75979055"
     variation       1264..1265
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:35988670"
     variation       1271
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377186754"
     variation       1274
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370596448"
     variation       1297
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:966191"
     exon            1326..1468
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /inference="alignment:Splign:1.39.8"
     variation       1337
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:371828635"
     variation       1339
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:183771544"
     variation       1405
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375119204"
     variation       1427
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:369520659"
     exon            1469..1594
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /inference="alignment:Splign:1.39.8"
     variation       1515
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374663038"
     exon            1595..1673
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /inference="alignment:Splign:1.39.8"
     variation       1635
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:373073447"
     variation       1641
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376408973"
     variation       1648
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370490867"
     variation       1663
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:185768707"
     exon            1674..1994
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /inference="alignment:Splign:1.39.8"
     STS             1685..1870
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /standard_name="RH99094"
                     /db_xref="UniSTS:83970"
     variation       1688
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148565354"
     variation       1692
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374445520"
     variation       1703
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202020074"
     variation       1716
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368852267"
     variation       1722
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17852859"
     variation       1743
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374403792"
     variation       1810
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:367948856"
     variation       1819
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199502210"
     variation       1824
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142956576"
     variation       1834
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377079128"
     variation       1863
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201413831"
     variation       1882
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202246545"
     variation       1891
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151112215"
     variation       1906
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:200612237"
     variation       1944
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1059432"
     variation       1951
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374578661"
     polyA_signal    1974..1979
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
     polyA_site      1994
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
ORIGIN      
aacgcccccgccgagcgggcggatcgagttcctctctggctggtgggctgcaagcggcagagcccgcccgcacagcccagcttttttctttctacccagactctcaacttgaccgcgcgttggtctgtgcgcccgctaacgtgccaggcacgcgccggggagctccgggatatgctccgcggtgctaccggtgacaagtgtggtatctggaatttgtgtagttctttgccccctgtctcaaccacaaaccttgacgacacagtatggccaggggccgagctcctcccttgcccactttgttctccagactgctaggagtcaagagtcagcttgtctccccagactcttcctgggagggatgagaggtttatgtgagttctactggcaggaatttggcataaaaggtttcagtgtagctcagaagccatttggagccacgtatgtatggagcagcatcataaacactcttcaaacacaagtggaagtgaaaaaacgaaggcaccgtttaaaacgacataatgactgctttgttggttcagaagctgtggatgtcattttttctcacctaattcagaataagtattttggtgatgtagatattcctcgagccaaagtggtgagagtgtgtcaagcgcttatggactacaaagtatttgaagcagttccaaccaaagtctttggaaaagacaaaaaacctacatttgaagatagtagttgcagcctttatagattcaccacaatacctaaccaagacagtcagttaggcaaagagaacaaactatattcacctgccaggtatgcagatgcattatttaagtcatccgatatcagatcagccagtttagaggacctgtgggaaaatctgagtttaaagcctgccaactcccctcatgtaaatatctctgcaaccttgtctccacaagttattaatgaagtgtggcaagaagaaacaattgggcgtctactacaacttgtagaccttccacttcttgactccttactgaaacagcaagaggctgtacctaaaattcctcaacctaagaggcagtccaccatggtcaacagcagtaactatctggatcgagggattctcaaggcttatagtgactctcaggaagatgagtggctctcggcagcaattgactgtttagaataccttccagaccaaatggtggtggaaataagcagaagctttcctgagcaaccagaccgaacagacttagtgaaagaacttctgtttgatgccattggcagatattacagtagtagggaacctctgttaaatcacttatctgacgttcataatggaattgcagaactcttagtgaatgggaagacggaaatagctttagaagctacccagctccttctaaagcttttagatttccaaaatagagaagaatttagaagactactgtatttcatggctgttgcagcaaatccttctgagtttaaattacagaaagaaagtgacaaccgaatggttgtgaaaaggatattctcaaaagctattgttgacaataaaaatttatccaaaggcaaaacagatcttctggtactctttttaatggatcatcagaaagatgtttttaagattcctggaactctacataaaattgtaagtgttaagcttatggccatacagaacggaagagatccaaatagagatgcaggatatatttattgccagagaattgatcaacgtgactattccaacaatacagagaagacaaccaaagatgagctgttgaatttactaaaaactcttgatgaggattcaaaactttctgccaaagagaagaaaaaattgctaggtcaattctataagtgtcacccagacatctttattgagcattttggagactgagtttttaatatctgtatataagttgtgtattttaagaataaattatgtatcctaaatatccaatcacatttgtaagcgtggaagctctaaatttgaaactgtacttaataaaaatttttttgtataaaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:91614 -> Molecular function: GO:0003674 [molecular_function] evidence: ND
            GeneID:91614 -> Biological process: GO:0007264 [small GTPase mediated signal transduction] evidence: TAS
            GeneID:91614 -> Biological process: GO:0008150 [biological_process] evidence: ND
            GeneID:91614 -> Biological process: GO:0051056 [regulation of small GTPase mediated signal transduction] evidence: TAS
            GeneID:91614 -> Cellular component: GO:0005575 [cellular_component] evidence: ND
            GeneID:91614 -> Cellular component: GO:0005829 [cytosol] evidence: TAS

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.