2024-04-24 07:50:54, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_138957 1499 bp mRNA linear PRI 15-JUL-2013 DEFINITION Homo sapiens mitogen-activated protein kinase 1 (MAPK1), transcript variant 2, mRNA. ACCESSION NM_138957 VERSION NM_138957.2 GI:75709179 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1499) AUTHORS Piechota-Polanczyk,A., Demyanets,S., Nykonenko,O., Huk,I., Mittlboeck,M., Domenig,C.M., Neumayer,C., Wojta,J., Nanobachvili,J. and Klinger,M. TITLE Decreased tissue levels of cyclophilin A, a cyclosporine a target and phospho-ERK1/2 in simvastatin patients with abdominal aortic aneurysm JOURNAL Eur J Vasc Endovasc Surg 45 (6), 682-688 (2013) PUBMED 23558220 REMARK GeneRIF: Simvastatin-treated patients with abdominal aortic aneurysms exert lower CyPA mRNA/protein levels and a decreased amount of phospho-ERK1/2. REFERENCE 2 (bases 1 to 1499) AUTHORS Suen,K.M., Lin,C.C., George,R., Melo,F.A., Biggs,E.R., Ahmed,Z., Drake,M.N., Arur,S., Arold,S.T. and Ladbury,J.E. TITLE Interaction with Shc prevents aberrant Erk activation in the absence of extracellular stimuli JOURNAL Nat. Struct. Mol. Biol. 20 (5), 620-627 (2013) PUBMED 23584453 REMARK GeneRIF: The Shc-Erk complex restricts Erk nuclear translocation, restraining Erk-dependent transcription of genes, including those responsible for oncogenic growth. REFERENCE 3 (bases 1 to 1499) AUTHORS Ruppert,C., Deiss,K., Herrmann,S., Vidal,M., Oezkur,M., Gorski,A., Weidemann,F., Lohse,M.J. and Lorenz,K. TITLE Interference with ERK(Thr188) phosphorylation impairs pathological but not physiological cardiac hypertrophy JOURNAL Proc. Natl. Acad. Sci. U.S.A. 110 (18), 7440-7445 (2013) PUBMED 23589880 REMARK GeneRIF: Interference with ERK(Thr188) phosphorylation permits the impairment of ERK1/2-mediated cardiac hypertrophy without increasing cardiomyocyte death. REFERENCE 4 (bases 1 to 1499) AUTHORS Yu,J.W., Farias,A., Hwang,I., Fernandes-Alnemri,T. and Alnemri,E.S. TITLE Ribotoxic stress through p38 mitogen-activated protein kinase activates in vitro the human pyrin inflammasome JOURNAL J. Biol. Chem. 288 (16), 11378-11383 (2013) PUBMED 23479736 REMARK GeneRIF: ribotoxic stress activates the human pyrin inflammasome through a mechanism that requires p38 MAPK signaling and microtubule stability. REFERENCE 5 (bases 1 to 1499) AUTHORS Ratajczak-Wrona,W., Jablonska,E., Garley,M., Jablonski,J. and Radziwon,P. TITLE Role of ERK1/2 kinase in the expression of iNOS by NDMA in human neutrophils JOURNAL Indian J. Exp. Biol. 51 (1), 73-80 (2013) PUBMED 23441482 REMARK GeneRIF: in human neutrophils, ERK1/2 kinase is not directly involved in the regulation of iNOS and NO production induced by NDMA; however, the kinase participates in superoxide anion production in these cells REFERENCE 6 (bases 1 to 1499) AUTHORS Goedert,M., Cohen,E.S., Jakes,R. and Cohen,P. TITLE p42 MAP kinase phosphorylation sites in microtubule-associated protein tau are dephosphorylated by protein phosphatase 2A1. Implications for Alzheimer's disease [corrected] JOURNAL FEBS Lett. 312 (1), 95-99 (1992) PUBMED 1330687 REMARK Erratum:[FEBS Lett 1992 Nov 23;313(2):203] REFERENCE 7 (bases 1 to 1499) AUTHORS Rossomando,A.J., Wu,J., Michel,H., Shabanowitz,J., Hunt,D.F., Weber,M.J. and Sturgill,T.W. TITLE Identification of Tyr-185 as the site of tyrosine autophosphorylation of recombinant mitogen-activated protein kinase p42mapk JOURNAL Proc. Natl. Acad. Sci. U.S.A. 89 (13), 5779-5783 (1992) PUBMED 1378617 REFERENCE 8 (bases 1 to 1499) AUTHORS Gonzalez,F.A., Raden,D.L., Rigby,M.R. and Davis,R.J. TITLE Heterogeneous expression of four MAP kinase isoforms in human tissues JOURNAL FEBS Lett. 304 (2-3), 170-178 (1992) PUBMED 1319925 REFERENCE 9 (bases 1 to 1499) AUTHORS Owaki,H., Makar,R., Boulton,T.G., Cobb,M.H. and Geppert,T.D. TITLE Extracellular signal-regulated kinases in T cells: characterization of human ERK1 and ERK2 cDNAs JOURNAL Biochem. Biophys. Res. Commun. 182 (3), 1416-1422 (1992) PUBMED 1540184 REFERENCE 10 (bases 1 to 1499) AUTHORS Chan,J. and Watt,V.M. TITLE eek and erk, new members of the eph subclass of receptor protein-tyrosine kinases JOURNAL Oncogene 6 (6), 1057-1061 (1991) PUBMED 1648701 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BC017832.1 and AI004470.1. On Sep 15, 2005 this sequence version replaced gi:20986530. Summary: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene. [provided by RefSeq, Jul 2008]. Transcript Variant: This variant (2) contains a different 3' UTR region, compared to variant 1. Both variants 1 and 2 encode the same protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC017832.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1484 BC017832.1 1-1484 1485-1499 AI004470.1 1-15 c FEATURES Location/Qualifiers source 1..1499 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="22" /map="22q11.21" gene 1..1499 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /note="mitogen-activated protein kinase 1" /db_xref="GeneID:5594" /db_xref="HGNC:6871" /db_xref="HPRD:01496" /db_xref="MIM:176948" exon 1..359 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /inference="alignment:Splign:1.39.8" variation 112 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /replace="a" /replace="c" /db_xref="dbSNP:61762565" variation 114 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /replace="g" /replace="t" /db_xref="dbSNP:61762566" misc_feature 178..180 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /note="upstream in-frame stop codon" CDS 241..1323 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /EC_number="2.7.11.24" /note="protein tyrosine kinase ERK2; extracellular signal-regulated kinase 2; mitogen-activated protein kinase 2; ERK-2; MAPK 2; p42-MAPK; MAP kinase 1; MAP kinase 2; MAP kinase isoform p42" /codon_start=1 /product="mitogen-activated protein kinase 1" /protein_id="NP_620407.1" /db_xref="GI:20986531" /db_xref="CCDS:CCDS13795.1" /db_xref="GeneID:5594" /db_xref="HGNC:6871" /db_xref="HPRD:01496" /db_xref="MIM:176948" /translation="
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
" misc_feature 244..246 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /experiment="experimental evidence, no additional details recorded" /note="N-acetylalanine; propagated from UniProtKB/Swiss-Prot (P28482.3); acetylation site" misc_feature 295..1233 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /note="Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases; Region: STKc_ERK1_2_like; cd07849" /db_xref="CDD:143354" misc_feature 313..1179 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /note="Serine/Threonine protein kinases, catalytic domain; Region: S_TKc; smart00220" /db_xref="CDD:214567" misc_feature 325..327 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine, by SGK1; propagated from UniProtKB/Swiss-Prot (P28482.3); phosphorylation site" misc_feature order(331..342,346..351,355..357,394..396,400..402, 448..450,490..492,553..564,571..573,577..582,685..687, 691..693,697..702,706..708,736..741,748..750,793..795, 799..810,814..816,928..930) /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /note="active site" /db_xref="CDD:143354" misc_feature order(331..342,346..351,355..357,394..396,400..402, 490..492,553..564,571..573,580..582,697..702,706..708, 736..741) /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /note="ATP binding site [chemical binding]; other site" /db_xref="CDD:143354" misc_feature 361..363 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /citation=[7] /db_xref="HPRD:01496" misc_feature order(448..450,577..579,685..687,691..693,748..750, 793..795,799..810,814..816,928..930) /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /note="substrate binding site [chemical binding]; other site" /db_xref="CDD:143354" misc_feature order(481..483,565..570,580..585,592..597,610..615, 622..624,631..633,643..645,709..726,1186..1188,1192..1194, 1201..1203) /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /note="KIM docking site [polypeptide binding]; other site" /db_xref="CDD:143354" misc_feature 553..564 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P28482.3); Region: Inhibitor-binding" misc_feature 697..702 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P28482.3); Region: Inhibitor-binding" misc_feature 736..816 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /note="activation loop (A-loop); other site" /db_xref="CDD:143354" misc_feature 793..801 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P28482.3); Region: TXY" misc_feature 793..795 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /experiment="experimental evidence, no additional details recorded" /note="dephosphorylation site; modified site" /db_xref="HPRD:02835" misc_feature 793..795 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /experiment="experimental evidence, no additional details recorded" /note="Phosphothreonine, by MAP2K1 and MAP2K2; propagated from UniProtKB/Swiss-Prot (P28482.3); phosphorylation site" misc_feature 793..795 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /citation=[7] /db_xref="HPRD:01496" misc_feature 799..801 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /experiment="experimental evidence, no additional details recorded" /note="dephosphorylation site; modified site" /db_xref="HPRD:01477" misc_feature 799..801 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /experiment="experimental evidence, no additional details recorded" /note="dephosphorylation site; modified site" /db_xref="HPRD:01480" misc_feature 799..801 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /experiment="experimental evidence, no additional details recorded" /note="dephosphorylation site; modified site" /db_xref="HPRD:02835" misc_feature 799..801 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /experiment="experimental evidence, no additional details recorded" /note="Phosphotyrosine, by MAP2K1 and MAP2K2; propagated from UniProtKB/Swiss-Prot (P28482.3); phosphorylation site" misc_feature 799..801 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /citation=[7] /db_xref="HPRD:01496" misc_feature 799..801 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:01266" misc_feature 799..801 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:01469" misc_feature 808..810 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /experiment="experimental evidence, no additional details recorded" /note="Phosphothreonine, by autocatalysis; propagated from UniProtKB/Swiss-Prot (P28482.3); phosphorylation site" misc_feature 853..855 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" misc_feature 976..978 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (P28482.3); phosphorylation site" misc_feature 982..984 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (P28482.3); phosphorylation site" misc_feature 1090..1092 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (P28482.3); phosphorylation site" misc_feature 1192..1206 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P28482.3); Region: Cytoplasmic retention motif" misc_feature 1219..1239 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P28482.3); Region: Nuclear translocation motif" exon 360..542 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /inference="alignment:Splign:1.39.8" variation 369 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /replace="c" /replace="t" /db_xref="dbSNP:3729910" exon 543..732 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /inference="alignment:Splign:1.39.8" exon 733..849 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /inference="alignment:Splign:1.39.8" exon 850..964 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /inference="alignment:Splign:1.39.8" variation 909 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /replace="c" /replace="t" /db_xref="dbSNP:1048748" variation 954 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /replace="c" /replace="t" /db_xref="dbSNP:1130164" exon 965..1096 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /inference="alignment:Splign:1.39.8" exon 1097..1206 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /inference="alignment:Splign:1.39.8" variation 1203 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /replace="c" /replace="t" /db_xref="dbSNP:1803545" exon 1207..1497 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /inference="alignment:Splign:1.39.8" variation 1435 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" /replace="a" /replace="g" /db_xref="dbSNP:3188781" polyA_signal 1469..1474 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" polyA_site 1497 /gene="MAPK1" /gene_synonym="ERK; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; P42MAPK; PRKM1; PRKM2" ORIGIN
gcccctccctccgcccgcccgccggcccgcccgtcagtctggcaggcaggcaggcaatcggtccgagtggctgtcggctcttcagctctcccgctcggcgtcttccttcctcctcccggtcagcgtcggcggctgcaccggcggcggcgcagtccctgcgggaggggcgacaagagctgagcggcggccgccgagcgtcgagctcagcgcggcggaggcggcggcggcccggcagccaacatggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgacgtggggccgcgctacaccaacctctcgtacatcggcgagggcgcctacggcatggtgtgctctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagcccctttgagcaccagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacatgagaacatcattggaatcaatgacattattcgagcaccaaccatcgagcaaatgaaagatgtatatatagtacaggacctcatggaaacagatctttacaagctcttgaagacacaacacctcagcaatgaccatatctgctattttctctaccagatcctcagagggttaaaatatatccattcagctaacgttctgcaccgtgacctcaagccttccaacctgctgctcaacaccacctgtgatctcaagatctgtgactttggcctggcccgtgttgcagatccagaccatgatcacacagggttcctgacagaatatgtggccacacgttggtacagggctccagaaattatgttgaattccaagggctacaccaagtccattgatatttggtctgtaggctgcattctggcagaaatgctttctaacaggcccatctttccagggaagcattatcttgaccagctgaaccacattttgggtattcttggatccccatcacaagaagacctgaattgtataataaatttaaaagctaggaactatttgctttctcttccacacaaaaataaggtgccatggaacaggctgttcccaaatgctgactccaaagctctggacttattggacaaaatgttgacattcaacccacacaagaggattgaagtagaacaggctctggcccacccatatctggagcagtattacgacccgagtgacgagcccatcgccgaagcaccattcaagttcgacatggaattggatgacttgcctaaggaaaagctcaaagaactaatttttgaagagactgctagattccagccaggatacagatcttaaatttgtcaggtacctggagtttaatacagtgagctctagcaagggaggcgctgccttttgtttctagaatattatgttcctcaaggtccattattttgtattcttttccaagctccttattggaaggtatttttttaaatttagaattaaaaattatttagaaagttacatataaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:5594 -> Molecular function: GO:0001784 [phosphotyrosine binding] evidence: IEA GeneID:5594 -> Molecular function: GO:0003677 [DNA binding] evidence: IEA GeneID:5594 -> Molecular function: GO:0004674 [protein serine/threonine kinase activity] evidence: IDA GeneID:5594 -> Molecular function: GO:0004707 [MAP kinase activity] evidence: IEA GeneID:5594 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:5594 -> Molecular function: GO:0005524 [ATP binding] evidence: IEA GeneID:5594 -> Molecular function: GO:0008134 [transcription factor binding] evidence: IEA GeneID:5594 -> Molecular function: GO:0008353 [RNA polymerase II carboxy-terminal domain kinase activity] evidence: ISS GeneID:5594 -> Molecular function: GO:0019902 [phosphatase binding] evidence: IPI GeneID:5594 -> Molecular function: GO:0031435 [mitogen-activated protein kinase kinase kinase binding] evidence: IEA GeneID:5594 -> Biological process: GO:0000165 [MAPK cascade] evidence: TAS GeneID:5594 -> Biological process: GO:0000186 [activation of MAPKK activity] evidence: TAS GeneID:5594 -> Biological process: GO:0000187 [activation of MAPK activity] evidence: TAS GeneID:5594 -> Biological process: GO:0000189 [MAPK import into nucleus] evidence: IEA GeneID:5594 -> Biological process: GO:0002224 [toll-like receptor signaling pathway] evidence: TAS GeneID:5594 -> Biological process: GO:0002755 [MyD88-dependent toll-like receptor signaling pathway] evidence: TAS GeneID:5594 -> Biological process: GO:0002756 [MyD88-independent toll-like receptor signaling pathway] evidence: TAS GeneID:5594 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA GeneID:5594 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA GeneID:5594 -> Biological process: GO:0006917 [induction of apoptosis] evidence: TAS GeneID:5594 -> Biological process: GO:0006935 [chemotaxis] evidence: TAS GeneID:5594 -> Biological process: GO:0006950 [response to stress] evidence: TAS GeneID:5594 -> Biological process: GO:0006974 [response to DNA damage stimulus] evidence: IEA GeneID:5594 -> Biological process: GO:0007049 [cell cycle] evidence: IEA GeneID:5594 -> Biological process: GO:0007165 [signal transduction] evidence: TAS GeneID:5594 -> Biological process: GO:0007173 [epidermal growth factor receptor signaling pathway] evidence: TAS GeneID:5594 -> Biological process: GO:0007264 [small GTPase mediated signal transduction] evidence: TAS GeneID:5594 -> Biological process: GO:0007265 [Ras protein signal transduction] evidence: TAS GeneID:5594 -> Biological process: GO:0007268 [synaptic transmission] evidence: TAS GeneID:5594 -> Biological process: GO:0007411 [axon guidance] evidence: TAS GeneID:5594 -> Biological process: GO:0007596 [blood coagulation] evidence: TAS GeneID:5594 -> Biological process: GO:0008284 [positive regulation of cell proliferation] evidence: IEA GeneID:5594 -> Biological process: GO:0008286 [insulin receptor signaling pathway] evidence: TAS GeneID:5594 -> Biological process: GO:0008543 [fibroblast growth factor receptor signaling pathway] evidence: TAS GeneID:5594 -> Biological process: GO:0009636 [response to toxic substance] evidence: IEA GeneID:5594 -> Biological process: GO:0009887 [organ morphogenesis] evidence: IEA GeneID:5594 -> Biological process: GO:0010800 [positive regulation of peptidyl-threonine phosphorylation] evidence: IDA GeneID:5594 -> Biological process: GO:0018105 [peptidyl-serine phosphorylation] evidence: IDA GeneID:5594 -> Biological process: GO:0019048 [modulation by virus of host morphology or physiology] evidence: IEA GeneID:5594 -> Biological process: GO:0019233 [sensory perception of pain] evidence: IEA GeneID:5594 -> Biological process: GO:0019858 [cytosine metabolic process] evidence: IEA GeneID:5594 -> Biological process: GO:0030168 [platelet activation] evidence: TAS GeneID:5594 -> Biological process: GO:0030335 [positive regulation of cell migration] evidence: IEA GeneID:5594 -> Biological process: GO:0031663 [lipopolysaccharide-mediated signaling pathway] evidence: IEA GeneID:5594 -> Biological process: GO:0032872 [regulation of stress-activated MAPK cascade] evidence: TAS GeneID:5594 -> Biological process: GO:0033598 [mammary gland epithelial cell proliferation] evidence: IEA GeneID:5594 -> Biological process: GO:0034134 [toll-like receptor 2 signaling pathway] evidence: TAS GeneID:5594 -> Biological process: GO:0034138 [toll-like receptor 3 signaling pathway] evidence: TAS GeneID:5594 -> Biological process: GO:0034142 [toll-like receptor 4 signaling pathway] evidence: TAS GeneID:5594 -> Biological process: GO:0034146 [toll-like receptor 5 signaling pathway] evidence: TAS GeneID:5594 -> Biological process: GO:0034162 [toll-like receptor 9 signaling pathway] evidence: TAS GeneID:5594 -> Biological process: GO:0034166 [toll-like receptor 10 signaling pathway] evidence: TAS GeneID:5594 -> Biological process: GO:0035666 [TRIF-dependent toll-like receptor signaling pathway] evidence: TAS GeneID:5594 -> Biological process: GO:0038095 [Fc-epsilon receptor signaling pathway] evidence: TAS GeneID:5594 -> Biological process: GO:0038096 [Fc-gamma receptor signaling pathway involved in phagocytosis] evidence: TAS GeneID:5594 -> Biological process: GO:0038123 [toll-like receptor TLR1:TLR2 signaling pathway] evidence: TAS GeneID:5594 -> Biological process: GO:0038124 [toll-like receptor TLR6:TLR2 signaling pathway] evidence: TAS GeneID:5594 -> Biological process: GO:0038127 [ERBB signaling pathway] evidence: IDA GeneID:5594 -> Biological process: GO:0043330 [response to exogenous dsRNA] evidence: IEA GeneID:5594 -> Biological process: GO:0043627 [response to estrogen stimulus] evidence: IEA GeneID:5594 -> Biological process: GO:0045087 [innate immune response] evidence: TAS GeneID:5594 -> Biological process: GO:0045596 [negative regulation of cell differentiation] evidence: IEA GeneID:5594 -> Biological process: GO:0045727 [positive regulation of translation] evidence: IEA GeneID:5594 -> Biological process: GO:0045893 [positive regulation of transcription, DNA-dependent] evidence: IEA GeneID:5594 -> Biological process: GO:0048011 [neurotrophin TRK receptor signaling pathway] evidence: TAS GeneID:5594 -> Biological process: GO:0050852 [T cell receptor signaling pathway] evidence: IEA GeneID:5594 -> Biological process: GO:0050853 [B cell receptor signaling pathway] evidence: IEA GeneID:5594 -> Biological process: GO:0051090 [regulation of sequence-specific DNA binding transcription factor activity] evidence: TAS GeneID:5594 -> Biological process: GO:0051403 [stress-activated MAPK cascade] evidence: TAS GeneID:5594 -> Biological process: GO:0051493 [regulation of cytoskeleton organization] evidence: TAS GeneID:5594 -> Biological process: GO:0060397 [JAK-STAT cascade involved in growth hormone signaling pathway] evidence: TAS GeneID:5594 -> Biological process: GO:0060716 [labyrinthine layer blood vessel development] evidence: IEA GeneID:5594 -> Biological process: GO:0070371 [ERK1 and ERK2 cascade] evidence: IDA GeneID:5594 -> Biological process: GO:0070371 [ERK1 and ERK2 cascade] evidence: TAS GeneID:5594 -> Biological process: GO:0070849 [response to epidermal growth factor stimulus] evidence: IDA GeneID:5594 -> Biological process: GO:0072584 [caveolin-mediated endocytosis] evidence: TAS GeneID:5594 -> Biological process: GO:0090170 [regulation of Golgi inheritance] evidence: TAS GeneID:5594 -> Biological process: GO:2000641 [regulation of early endosome to late endosome transport] evidence: TAS GeneID:5594 -> Cellular component: GO:0005634 [nucleus] evidence: IDA GeneID:5594 -> Cellular component: GO:0005634 [nucleus] evidence: TAS GeneID:5594 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS GeneID:5594 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA GeneID:5594 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA GeneID:5594 -> Cellular component: GO:0005739 [mitochondrion] evidence: TAS GeneID:5594 -> Cellular component: GO:0005769 [early endosome] evidence: TAS GeneID:5594 -> Cellular component: GO:0005770 [late endosome] evidence: TAS GeneID:5594 -> Cellular component: GO:0005794 [Golgi apparatus] evidence: TAS GeneID:5594 -> Cellular component: GO:0005815 [microtubule organizing center] evidence: IEA GeneID:5594 -> Cellular component: GO:0005819 [spindle] evidence: IEA GeneID:5594 -> Cellular component: GO:0005829 [cytosol] evidence: TAS GeneID:5594 -> Cellular component: GO:0005856 [cytoskeleton] evidence: TAS GeneID:5594 -> Cellular component: GO:0005901 [caveola] evidence: TAS GeneID:5594 -> Cellular component: GO:0005925 [focal adhesion] evidence: TAS GeneID:5594 -> Cellular component: GO:0015630 [microtubule cytoskeleton] evidence: IDA GeneID:5594 -> Cellular component: GO:0031143 [pseudopodium] evidence: IEA GeneID:5594 -> Cellular component: GO:0032839 [dendrite cytoplasm] evidence: IEA GeneID:5594 -> Cellular component: GO:0043204 [perikaryon] evidence: IEA ANNOTATIONS from NCBI Entrez Gene (20130726): NP_620407 -> EC 2.7.11.24
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.