Home |
Help |
Advanced search
2024-04-19 23:54:11, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_138764 849 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens BCL2-associated X protein (BAX), transcript variant
sigma, mRNA.
ACCESSION NM_138764 NM_138765
VERSION NM_138764.4 GI:242117892
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 849)
AUTHORS Li,Y., Zhao,Y., Cheng,Z., Zhan,J., Sun,X., Qian,H., Zhu,W. and
Xu,W.
TITLE Mesenchymal stem cell-like cells from children foreskin inhibit the
growth of SGC-7901 gastric cancer cells
JOURNAL Exp. Mol. Pathol. 94 (3), 430-437 (2013)
PUBMED 23421973
REMARK GeneRIF: Human mesenchymal stem cell-like cells from foreskin
derived conditioned medium inhibited the expression of BCL-2 while
increased the expression of BAX and caspase-3 in gastric cancer
cells.
REFERENCE 2 (bases 1 to 849)
AUTHORS Zhang,A., Hildreth,R.L. and Colberg-Poley,A.M.
TITLE Human cytomegalovirus inhibits apoptosis by proteasome-mediated
degradation of Bax at endoplasmic reticulum-mitochondrion contacts
JOURNAL J. Virol. 87 (10), 5657-5668 (2013)
PUBMED 23487455
REMARK GeneRIF: Authors establish that the UL37 exon 1 protein retargets
Bax to the mitochondrion-associated membranes as well as to the
outer mitochondrial membrane from immediate early through late
times of infection.
REFERENCE 3 (bases 1 to 849)
AUTHORS Nayak,M.K., Kulkarni,P.P. and Dash,D.
TITLE Regulatory role of proteasome in determination of platelet life
span
JOURNAL J. Biol. Chem. 288 (10), 6826-6834 (2013)
PUBMED 23329846
REMARK GeneRIF: Data indicate a critical role of proteasome in delimiting
platelet life span ostensibly through constitutive elimination of
the conformationally active Bax.
REFERENCE 4 (bases 1 to 849)
AUTHORS Kim,M.S., Kim,S.S., Yoo,N.J. and Lee,S.H.
TITLE Rare somatic mutation of pro-apoptotic BAX and BAK genes in common
human cancers
JOURNAL Tumori 98 (6), 149E-151E (2012)
PUBMED 23389372
REMARK GeneRIF: data indicate that somatic mutation of BAX and BAK genes
are rare in the common cancers (besides the cancers with high
microsatellite instability) and suggest that neither BAX nor BAK
mutation may causally be implicated in their tumorigenesis
REFERENCE 5 (bases 1 to 849)
AUTHORS Kopinski,P., Dyczek,A., Chorostowska-Wynimko,J., Marszalek,A.,
Balicka-Slusarczyk,B., Kubiszewska,I., Szablowska,K., Polgesek,E.
and Szpechcinski,A.
TITLE [Higher incidence of alveolar lymphocytes (AL) apoptosis in smokers
depends on BCL-2 expression and specific response to tumor necrosis
factor alpha (TNFalpha). Bronchoalveolar lavage (BAL) material
analysis from selected interstitial lung diseases (ILD) and healthy
controls]
JOURNAL Prz. Lek. 69 (10), 731-736 (2012)
PUBMED 23421021
REMARK GeneRIF: The most likely mechanisms involve down-regulation of
BCL-2 expression and altered alveolar lymphocyte susceptibility to
TNFalpha in smokers with idiopathic pulmonary ibrosis and pulmonary
sarcoidosis.
REFERENCE 6 (bases 1 to 849)
AUTHORS Chittenden,T., Flemington,C., Houghton,A.B., Ebb,R.G., Gallo,G.J.,
Elangovan,B., Chinnadurai,G. and Lutz,R.J.
TITLE A conserved domain in Bak, distinct from BH1 and BH2, mediates cell
death and protein binding functions
JOURNAL EMBO J. 14 (22), 5589-5596 (1995)
PUBMED 8521816
REFERENCE 7 (bases 1 to 849)
AUTHORS Adams,M.D., Kerlavage,A.R., Fleischmann,R.D., Fuldner,R.A.,
Bult,C.J., Lee,N.H., Kirkness,E.F., Weinstock,K.G., Gocayne,J.D.,
White,O. et al.
TITLE Initial assessment of human gene diversity and expression patterns
based upon 83 million nucleotides of cDNA sequence
JOURNAL Nature 377 (6547 SUPPL), 3-174 (1995)
PUBMED 7566098
REFERENCE 8 (bases 1 to 849)
AUTHORS Apte,S.S., Mattei,M.G. and Olsen,B.R.
TITLE Mapping of the human BAX gene to chromosome 19q13.3-q13.4 and
isolation of a novel alternatively spliced transcript, BAX delta
JOURNAL Genomics 26 (3), 592-594 (1995)
PUBMED 7607685
REFERENCE 9 (bases 1 to 849)
AUTHORS Miyashita,T. and Reed,J.C.
TITLE Tumor suppressor p53 is a direct transcriptional activator of the
human bax gene
JOURNAL Cell 80 (2), 293-299 (1995)
PUBMED 7834749
REFERENCE 10 (bases 1 to 849)
AUTHORS Oltvai,Z.N., Milliman,C.L. and Korsmeyer,S.J.
TITLE Bcl-2 heterodimerizes in vivo with a conserved homolog, Bax, that
accelerates programmed cell death
JOURNAL Cell 74 (4), 609-619 (1993)
PUBMED 8358790
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BE396495.1, BC014175.2 and
AI565203.1.
On or before Jun 26, 2009 this sequence version replaced
gi:163659850, gi:163659851.
Summary: The protein encoded by this gene belongs to the BCL2
protein family. BCL2 family members form hetero- or homodimers and
act as anti- or pro-apoptotic regulators that are involved in a
wide variety of cellular activities. This protein forms a
heterodimer with BCL2, and functions as an apoptotic activator.
This protein is reported to interact with, and increase the opening
of, the mitochondrial voltage-dependent anion channel (VDAC), which
leads to the loss in membrane potential and the release of
cytochrome c. The expression of this gene is regulated by the tumor
suppressor P53 and has been shown to be involved in P53-mediated
apoptosis. Multiple alternatively spliced transcript variants,
which encode different isoforms, have been reported for this gene.
[provided by RefSeq, Jul 2008].
Transcript Variant: This variant (sigma) contains a distinct 3'
coding region and 3' UTR when compared to variant beta. It encodes
an isoform (sigma) that has a shorter and different C terminus, as
compared to isoform beta.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AF247393.1 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
ERS025084 [ECO:0000350]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-17 BE396495.1 1-17
18-543 BC014175.2 1-526
544-686 BC014175.2 566-708
687-687 AI565203.1 91-91 c
688-849 BC014175.2 710-871
FEATURES Location/Qualifiers
source 1..849
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="19"
/map="19q13.3-q13.4"
gene 1..849
/gene="BAX"
/gene_synonym="BCL2L4"
/note="BCL2-associated X protein"
/db_xref="GeneID:581"
/db_xref="HGNC:959"
/db_xref="MIM:600040"
exon 1..103
/gene="BAX"
/gene_synonym="BCL2L4"
/inference="alignment:Splign:1.39.8"
variation 53
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="c"
/replace="t"
/db_xref="dbSNP:200532779"
STS 69..610
/gene="BAX"
/gene_synonym="BCL2L4"
/standard_name="GDB:632822"
/db_xref="UniSTS:158495"
CDS 70..609
/gene="BAX"
/gene_synonym="BCL2L4"
/note="isoform sigma is encoded by transcript variant
sigma; apoptosis regulator BAX; bcl2-L-4; bcl-2-like
protein 4; BCL2-associated X protein omega;
BCL2-associated X protein transcript variant delta2"
/codon_start=1
/product="apoptosis regulator BAX isoform sigma"
/protein_id="NP_620119.2"
/db_xref="GI:242117893"
/db_xref="CCDS:CCDS12745.2"
/db_xref="GeneID:581"
/db_xref="HGNC:959"
/db_xref="MIM:600040"
/translation="
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWTVTIFVAGVLTASLTIWKKMG
"
misc_feature 82..606
/gene="BAX"
/gene_synonym="BCL2L4"
/note="apoptosis regulator; Region: bcl-2; TIGR00865"
/db_xref="CDD:162075"
misc_feature 142..543
/gene="BAX"
/gene_synonym="BCL2L4"
/note="Apoptosis regulator proteins of the Bcl-2 family,
named after B-cell lymphoma 2. This alignment model spans
what have been described as Bcl-2 homology regions BH1,
BH2, BH3, and BH4. Many members of this family have an
additional C-terminal transmembrane...; Region:
Bcl-2_like; cd06845"
/db_xref="CDD:132900"
misc_feature 142..171
/gene="BAX"
/gene_synonym="BCL2L4"
/note="BH4; other site"
/db_xref="CDD:132900"
misc_feature 256..282
/gene="BAX"
/gene_synonym="BCL2L4"
/note="BH3; other site"
/db_xref="CDD:132900"
misc_feature order(265..270,274..279,295..297,304..309,337..342,
349..354,361..366,385..387,391..396,400..405,415..417,
427..429)
/gene="BAX"
/gene_synonym="BCL2L4"
/note="BH3-homology region binding site; other site"
/db_xref="CDD:132900"
misc_feature order(361..369,382..420)
/gene="BAX"
/gene_synonym="BCL2L4"
/note="BH1; other site"
/db_xref="CDD:132900"
misc_feature 517..543
/gene="BAX"
/gene_synonym="BCL2L4"
/note="BH2; other site"
/db_xref="CDD:132900"
variation 95
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="a"
/replace="g"
/db_xref="dbSNP:74422693"
exon 104..155
/gene="BAX"
/gene_synonym="BCL2L4"
/inference="alignment:Splign:1.39.8"
variation 105
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="a"
/replace="g"
/db_xref="dbSNP:200327680"
variation 106..107
/gene="BAX"
/gene_synonym="BCL2L4"
/replace=""
/replace="c"
/db_xref="dbSNP:67198826"
STS 110..609
/gene="BAX"
/gene_synonym="BCL2L4"
/standard_name="PMC114802P1"
/db_xref="UniSTS:270279"
variation 110
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="c"
/replace="t"
/db_xref="dbSNP:144179827"
variation 112
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="a"
/replace="g"
/db_xref="dbSNP:151036634"
STS 117..574
/gene="BAX"
/gene_synonym="BCL2L4"
/standard_name="BARC0009"
/db_xref="UniSTS:255299"
variation 125
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="a"
/replace="t"
/db_xref="dbSNP:374123839"
variation 138
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="a"
/replace="g"
/db_xref="dbSNP:140986746"
exon 156..302
/gene="BAX"
/gene_synonym="BCL2L4"
/inference="alignment:Splign:1.39.8"
STS 157..302
/gene="BAX"
/gene_synonym="BCL2L4"
/standard_name="PMC230316P5"
/db_xref="UniSTS:272183"
STS 160..253
/gene="BAX"
/gene_synonym="BCL2L4"
/standard_name="PMC27116P1"
/db_xref="UniSTS:272373"
variation 171
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="a"
/replace="g"
/db_xref="dbSNP:145555385"
variation 174
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="a"
/replace="c"
/db_xref="dbSNP:4645885"
variation 183
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="c"
/replace="g"
/db_xref="dbSNP:141306106"
variation 184
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="c"
/replace="g"
/db_xref="dbSNP:36017265"
variation 185
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="g"
/replace="t"
/db_xref="dbSNP:147630961"
STS 227..392
/gene="BAX"
/gene_synonym="BCL2L4"
/standard_name="Bax"
/db_xref="UniSTS:265693"
variation 229
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="c"
/replace="g"
/db_xref="dbSNP:200153051"
variation 263
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="g"
/replace="t"
/db_xref="dbSNP:142278713"
variation 273
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="c"
/replace="t"
/db_xref="dbSNP:145765277"
variation 295
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="c"
/replace="t"
/db_xref="dbSNP:376911304"
exon 303..438
/gene="BAX"
/gene_synonym="BCL2L4"
/inference="alignment:Splign:1.39.8"
variation 315
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="c"
/replace="g"
/db_xref="dbSNP:370634054"
variation 333
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="c"
/replace="g"
/db_xref="dbSNP:374052135"
variation 335
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="a"
/replace="g"
/db_xref="dbSNP:202190487"
variation 375
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="c"
/replace="t"
/db_xref="dbSNP:148204524"
variation 388
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="a"
/replace="t"
/db_xref="dbSNP:367558446"
variation 402
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="c"
/replace="t"
/db_xref="dbSNP:201578495"
variation 407..408
/gene="BAX"
/gene_synonym="BCL2L4"
/replace=""
/replace="t"
/db_xref="dbSNP:66527050"
exon 439..543
/gene="BAX"
/gene_synonym="BCL2L4"
/inference="alignment:Splign:1.39.8"
variation 439
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="a"
/replace="g"
/db_xref="dbSNP:376997564"
variation 458
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="c"
/replace="t"
/db_xref="dbSNP:369660551"
variation 459
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="a"
/replace="g"
/db_xref="dbSNP:371947281"
variation 469
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="a"
/replace="g"
/db_xref="dbSNP:375291870"
variation 470
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="c"
/replace="g"
/db_xref="dbSNP:369570399"
variation 502
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="c"
/replace="t"
/db_xref="dbSNP:372506919"
variation 508
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="c"
/replace="t"
/db_xref="dbSNP:375752615"
variation 509
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="a"
/replace="g"
/db_xref="dbSNP:190602136"
exon 544..771
/gene="BAX"
/gene_synonym="BCL2L4"
/inference="alignment:Splign:1.39.8"
variation 547
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="a"
/replace="g"
/db_xref="dbSNP:377294979"
variation 582
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1057369"
variation 600
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="g"
/replace="t"
/db_xref="dbSNP:370817149"
variation 687
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="a"
/replace="g"
/db_xref="dbSNP:704243"
variation 723..724
/gene="BAX"
/gene_synonym="BCL2L4"
/replace=""
/replace="g"
/db_xref="dbSNP:72215802"
variation 727
/gene="BAX"
/gene_synonym="BCL2L4"
/replace="a"
/replace="g"
/db_xref="dbSNP:373416805"
polyA_signal 750..755
/gene="BAX"
/gene_synonym="BCL2L4"
polyA_site 771
/gene="BAX"
/gene_synonym="BCL2L4"
ORIGIN
tcacgtgacccgggcgcgctgcggccgcccgcgcggacccggcgagaggcggcggcgggagcggcggtgatggacgggtccggggagcagcccagaggcggggggcccaccagctctgagcagatcatgaagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatggggggggaggcacccgagctggccctggacccggtgcctcaggatgcgtccaccaagaagctgagcgagtgtctcaagcgcatcggggacgaactggacagtaacatggagctgcagaggatgattgccgccgtggacacagactccccccgagaggtctttttccgagtggcagctgacatgttttctgacggcaacttcaactggggccgggttgtcgcccttttctactttgccagcaaactggtgctcaaggccctgtgcaccaaggtgccggaactgatcagaaccatcatgggctggacattggacttcctccgggagcggctgttgggctggatccaagaccagggtggttggaccgtgaccatctttgtggcgggagtgctcaccgcctcactcaccatctggaagaagatgggctgaggcccccagctgccttggactgtgtttttcctccataaattatggcatttttctgggaggggtggggattgggggacgtgggcatttttcttacttttgtaattattggggggtgtggggaagagtggtcttgagggggtaataaacctccttcgggacacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:581 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:581 -> Molecular function: GO:0008289 [lipid binding] evidence: IDA
GeneID:581 -> Molecular function: GO:0015267 [channel activity] evidence: IDA
GeneID:581 -> Molecular function: GO:0042802 [identical protein binding] evidence: IPI
GeneID:581 -> Molecular function: GO:0042803 [protein homodimerization activity] evidence: IDA
GeneID:581 -> Molecular function: GO:0042803 [protein homodimerization activity] evidence: IPI
GeneID:581 -> Molecular function: GO:0046982 [protein heterodimerization activity] evidence: IPI
GeneID:581 -> Molecular function: GO:0051434 [BH3 domain binding] evidence: IDA
GeneID:581 -> Molecular function: GO:0051434 [BH3 domain binding] evidence: IPI
GeneID:581 -> Biological process: GO:0001101 [response to acid] evidence: IEA
GeneID:581 -> Biological process: GO:0001541 [ovarian follicle development] evidence: IEA
GeneID:581 -> Biological process: GO:0001764 [neuron migration] evidence: IEA
GeneID:581 -> Biological process: GO:0001777 [T cell homeostatic proliferation] evidence: IEA
GeneID:581 -> Biological process: GO:0001782 [B cell homeostasis] evidence: IEA
GeneID:581 -> Biological process: GO:0001783 [B cell apoptotic process] evidence: IDA
GeneID:581 -> Biological process: GO:0001822 [kidney development] evidence: IEA
GeneID:581 -> Biological process: GO:0001836 [release of cytochrome c from mitochondria] evidence: IDA
GeneID:581 -> Biological process: GO:0001844 [protein insertion into mitochondrial membrane involved in apoptotic signaling pathway] evidence: IEA
GeneID:581 -> Biological process: GO:0001974 [blood vessel remodeling] evidence: IEA
GeneID:581 -> Biological process: GO:0002262 [myeloid cell homeostasis] evidence: IEA
GeneID:581 -> Biological process: GO:0002352 [B cell negative selection] evidence: IEA
GeneID:581 -> Biological process: GO:0002358 [B cell homeostatic proliferation] evidence: IEA
GeneID:581 -> Biological process: GO:0002904 [positive regulation of B cell apoptotic process] evidence: IEA
GeneID:581 -> Biological process: GO:0006309 [apoptotic DNA fragmentation] evidence: IMP
GeneID:581 -> Biological process: GO:0006687 [glycosphingolipid metabolic process] evidence: IEA
GeneID:581 -> Biological process: GO:0006808 [regulation of nitrogen utilization] evidence: IEA
GeneID:581 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:581 -> Biological process: GO:0006917 [induction of apoptosis] evidence: NAS
GeneID:581 -> Biological process: GO:0006919 [activation of cysteine-type endopeptidase activity involved in apoptotic process] evidence: IDA
GeneID:581 -> Biological process: GO:0006919 [activation of cysteine-type endopeptidase activity involved in apoptotic process] evidence: IMP
GeneID:581 -> Biological process: GO:0006922 [cleavage of lamin involved in execution phase of apoptosis] evidence: IMP
GeneID:581 -> Biological process: GO:0006927 [transformed cell apoptotic process] evidence: IMP
GeneID:581 -> Biological process: GO:0006974 [response to DNA damage stimulus] evidence: IEA
GeneID:581 -> Biological process: GO:0007281 [germ cell development] evidence: IEA
GeneID:581 -> Biological process: GO:0008053 [mitochondrial fusion] evidence: IDA
GeneID:581 -> Biological process: GO:0008635 [activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c] evidence: IDA
GeneID:581 -> Biological process: GO:0008637 [apoptotic mitochondrial changes] evidence: IDA
GeneID:581 -> Biological process: GO:0009566 [fertilization] evidence: IEA
GeneID:581 -> Biological process: GO:0009636 [response to toxic substance] evidence: IDA
GeneID:581 -> Biological process: GO:0009651 [response to salt stress] evidence: IEA
GeneID:581 -> Biological process: GO:0010248 [establishment or maintenance of transmembrane electrochemical gradient] evidence: IDA
GeneID:581 -> Biological process: GO:0010332 [response to gamma radiation] evidence: IEA
GeneID:581 -> Biological process: GO:0019048 [modulation by virus of host morphology or physiology] evidence: IEA
GeneID:581 -> Biological process: GO:0021854 [hypothalamus development] evidence: IEA
GeneID:581 -> Biological process: GO:0021987 [cerebral cortex development] evidence: IEA
GeneID:581 -> Biological process: GO:0030264 [nuclear fragmentation involved in apoptotic nuclear change] evidence: IMP
GeneID:581 -> Biological process: GO:0032091 [negative regulation of protein binding] evidence: IDA
GeneID:581 -> Biological process: GO:0032461 [positive regulation of protein oligomerization] evidence: IDA
GeneID:581 -> Biological process: GO:0032471 [reduction of endoplasmic reticulum calcium ion concentration] evidence: IEA
GeneID:581 -> Biological process: GO:0032976 [release of matrix enzymes from mitochondria] evidence: IDA
GeneID:581 -> Biological process: GO:0033137 [negative regulation of peptidyl-serine phosphorylation] evidence: IEA
GeneID:581 -> Biological process: GO:0033599 [regulation of mammary gland epithelial cell proliferation] evidence: IEA
GeneID:581 -> Biological process: GO:0034644 [cellular response to UV] evidence: IEA
GeneID:581 -> Biological process: GO:0035108 [limb morphogenesis] evidence: IEA
GeneID:581 -> Biological process: GO:0035234 [germ cell programmed cell death] evidence: IEA
GeneID:581 -> Biological process: GO:0042475 [odontogenesis of dentin-containing tooth] evidence: IEA
GeneID:581 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: IMP
GeneID:581 -> Biological process: GO:0043496 [regulation of protein homodimerization activity] evidence: IDA
GeneID:581 -> Biological process: GO:0043497 [regulation of protein heterodimerization activity] evidence: IPI
GeneID:581 -> Biological process: GO:0043524 [negative regulation of neuron apoptotic process] evidence: IEA
GeneID:581 -> Biological process: GO:0043525 [positive regulation of neuron apoptotic process] evidence: IDA
GeneID:581 -> Biological process: GO:0043653 [mitochondrial fragmentation involved in apoptotic process] evidence: IDA
GeneID:581 -> Biological process: GO:0045136 [development of secondary sexual characteristics] evidence: IEA
GeneID:581 -> Biological process: GO:0046666 [retinal cell programmed cell death] evidence: IEA
GeneID:581 -> Biological process: GO:0048087 [positive regulation of developmental pigmentation] evidence: IEA
GeneID:581 -> Biological process: GO:0048147 [negative regulation of fibroblast proliferation] evidence: IEA
GeneID:581 -> Biological process: GO:0048515 [spermatid differentiation] evidence: IEA
GeneID:581 -> Biological process: GO:0048597 [post-embryonic camera-type eye morphogenesis] evidence: IEA
GeneID:581 -> Biological process: GO:0048678 [response to axon injury] evidence: IEA
GeneID:581 -> Biological process: GO:0048873 [homeostasis of number of cells within a tissue] evidence: IEA
GeneID:581 -> Biological process: GO:0051259 [protein oligomerization] evidence: IDA
GeneID:581 -> Biological process: GO:0051260 [protein homooligomerization] evidence: IDA
GeneID:581 -> Biological process: GO:0051281 [positive regulation of release of sequestered calcium ion into cytosol] evidence: IEA
GeneID:581 -> Biological process: GO:0051402 [neuron apoptotic process] evidence: IEA
GeneID:581 -> Biological process: GO:0051726 [regulation of cell cycle] evidence: IEA
GeneID:581 -> Biological process: GO:0051881 [regulation of mitochondrial membrane potential] evidence: IDA
GeneID:581 -> Biological process: GO:0060011 [Sertoli cell proliferation] evidence: IEA
GeneID:581 -> Biological process: GO:0060041 [retina development in camera-type eye] evidence: IEA
GeneID:581 -> Biological process: GO:0060058 [positive regulation of apoptotic process involved in mammary gland involution] evidence: IEA
GeneID:581 -> Biological process: GO:0060068 [vagina development] evidence: IEA
GeneID:581 -> Biological process: GO:0070059 [intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress] evidence: IMP
GeneID:581 -> Biological process: GO:0071310 [cellular response to organic substance] evidence: IEA
GeneID:581 -> Biological process: GO:0090200 [positive regulation of release of cytochrome c from mitochondria] evidence: IDA
GeneID:581 -> Biological process: GO:0097190 [apoptotic signaling pathway] evidence: IDA
GeneID:581 -> Biological process: GO:0097191 [extrinsic apoptotic signaling pathway] evidence: IDA
GeneID:581 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: IDA
GeneID:581 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: TAS
GeneID:581 -> Biological process: GO:1900103 [positive regulation of endoplasmic reticulum unfolded protein response] evidence: IMP
GeneID:581 -> Biological process: GO:1901030 [positive regulation of mitochondrial outer membrane permeabilization] evidence: TAS
GeneID:581 -> Biological process: GO:1990009 [retinal cell apoptotic process] evidence: IMP
GeneID:581 -> Biological process: GO:2001244 [positive regulation of intrinsic apoptotic signaling pathway] evidence: IMP
GeneID:581 -> Cellular component: GO:0005634 [nucleus] evidence: IMP
GeneID:581 -> Cellular component: GO:0005739 [mitochondrion] evidence: IDA
GeneID:581 -> Cellular component: GO:0005741 [mitochondrial outer membrane] evidence: TAS
GeneID:581 -> Cellular component: GO:0005757 [mitochondrial permeability transition pore complex] evidence: IDA
GeneID:581 -> Cellular component: GO:0005783 [endoplasmic reticulum] evidence: IDA
GeneID:581 -> Cellular component: GO:0005789 [endoplasmic reticulum membrane] evidence: IDA
GeneID:581 -> Cellular component: GO:0005829 [cytosol] evidence: IDA
GeneID:581 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:581 -> Cellular component: GO:0046930 [pore complex] evidence: IDA
GeneID:581 -> Cellular component: GO:0097136 [Bcl-2 family protein complex] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.