2024-04-26 06:59:20, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_138763 741 bp mRNA linear PRI 07-JUL-2013 DEFINITION Homo sapiens BCL2-associated X protein (BAX), transcript variant delta, mRNA. ACCESSION NM_138763 VERSION NM_138763.3 GI:163659849 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 741) AUTHORS Li,Y., Zhao,Y., Cheng,Z., Zhan,J., Sun,X., Qian,H., Zhu,W. and Xu,W. TITLE Mesenchymal stem cell-like cells from children foreskin inhibit the growth of SGC-7901 gastric cancer cells JOURNAL Exp. Mol. Pathol. 94 (3), 430-437 (2013) PUBMED 23421973 REMARK GeneRIF: Human mesenchymal stem cell-like cells from foreskin derived conditioned medium inhibited the expression of BCL-2 while increased the expression of BAX and caspase-3 in gastric cancer cells. REFERENCE 2 (bases 1 to 741) AUTHORS Zhang,A., Hildreth,R.L. and Colberg-Poley,A.M. TITLE Human cytomegalovirus inhibits apoptosis by proteasome-mediated degradation of Bax at endoplasmic reticulum-mitochondrion contacts JOURNAL J. Virol. 87 (10), 5657-5668 (2013) PUBMED 23487455 REMARK GeneRIF: Authors establish that the UL37 exon 1 protein retargets Bax to the mitochondrion-associated membranes as well as to the outer mitochondrial membrane from immediate early through late times of infection. REFERENCE 3 (bases 1 to 741) AUTHORS Nayak,M.K., Kulkarni,P.P. and Dash,D. TITLE Regulatory role of proteasome in determination of platelet life span JOURNAL J. Biol. Chem. 288 (10), 6826-6834 (2013) PUBMED 23329846 REMARK GeneRIF: Data indicate a critical role of proteasome in delimiting platelet life span ostensibly through constitutive elimination of the conformationally active Bax. REFERENCE 4 (bases 1 to 741) AUTHORS Kim,M.S., Kim,S.S., Yoo,N.J. and Lee,S.H. TITLE Rare somatic mutation of pro-apoptotic BAX and BAK genes in common human cancers JOURNAL Tumori 98 (6), 149E-151E (2012) PUBMED 23389372 REMARK GeneRIF: data indicate that somatic mutation of BAX and BAK genes are rare in the common cancers (besides the cancers with high microsatellite instability) and suggest that neither BAX nor BAK mutation may causally be implicated in their tumorigenesis REFERENCE 5 (bases 1 to 741) AUTHORS Kopinski,P., Dyczek,A., Chorostowska-Wynimko,J., Marszalek,A., Balicka-Slusarczyk,B., Kubiszewska,I., Szablowska,K., Polgesek,E. and Szpechcinski,A. TITLE [Higher incidence of alveolar lymphocytes (AL) apoptosis in smokers depends on BCL-2 expression and specific response to tumor necrosis factor alpha (TNFalpha). Bronchoalveolar lavage (BAL) material analysis from selected interstitial lung diseases (ILD) and healthy controls] JOURNAL Prz. Lek. 69 (10), 731-736 (2012) PUBMED 23421021 REMARK GeneRIF: The most likely mechanisms involve down-regulation of BCL-2 expression and altered alveolar lymphocyte susceptibility to TNFalpha in smokers with idiopathic pulmonary ibrosis and pulmonary sarcoidosis. REFERENCE 6 (bases 1 to 741) AUTHORS Chittenden,T., Flemington,C., Houghton,A.B., Ebb,R.G., Gallo,G.J., Elangovan,B., Chinnadurai,G. and Lutz,R.J. TITLE A conserved domain in Bak, distinct from BH1 and BH2, mediates cell death and protein binding functions JOURNAL EMBO J. 14 (22), 5589-5596 (1995) PUBMED 8521816 REFERENCE 7 (bases 1 to 741) AUTHORS Adams,M.D., Kerlavage,A.R., Fleischmann,R.D., Fuldner,R.A., Bult,C.J., Lee,N.H., Kirkness,E.F., Weinstock,K.G., Gocayne,J.D., White,O. et al. TITLE Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence JOURNAL Nature 377 (6547 SUPPL), 3-174 (1995) PUBMED 7566098 REFERENCE 8 (bases 1 to 741) AUTHORS Apte,S.S., Mattei,M.G. and Olsen,B.R. TITLE Mapping of the human BAX gene to chromosome 19q13.3-q13.4 and isolation of a novel alternatively spliced transcript, BAX delta JOURNAL Genomics 26 (3), 592-594 (1995) PUBMED 7607685 REFERENCE 9 (bases 1 to 741) AUTHORS Miyashita,T. and Reed,J.C. TITLE Tumor suppressor p53 is a direct transcriptional activator of the human bax gene JOURNAL Cell 80 (2), 293-299 (1995) PUBMED 7834749 REFERENCE 10 (bases 1 to 741) AUTHORS Oltvai,Z.N., Milliman,C.L. and Korsmeyer,S.J. TITLE Bcl-2 heterodimerizes in vivo with a conserved homolog, Bax, that accelerates programmed cell death JOURNAL Cell 74 (4), 609-619 (1993) PUBMED 8358790 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BE396495.1, BC014175.2 and AI565203.1. On Dec 20, 2007 this sequence version replaced gi:34335121. Summary: The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene. [provided by RefSeq, Jul 2008]. Transcript Variant: This variant (delta) lacks a segment within the coding region, and contains a distinct 3' coding region and 3' UTR, when compared to variant beta. The translation remains in-frame, and results in an isoform (delta) that is missing an internal segment, and has a shorter and different C terminus, as compared to isoform beta. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: U19599.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-17 BE396495.1 1-17 18-155 BC014175.2 1-138 156-578 BC014175.2 286-708 579-579 AI565203.1 91-91 c 580-741 BC014175.2 710-871 FEATURES Location/Qualifiers source 1..741 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="19" /map="19q13.3-q13.4" gene 1..741 /gene="BAX" /gene_synonym="BCL2L4" /note="BCL2-associated X protein" /db_xref="GeneID:581" /db_xref="HGNC:959" /db_xref="HPRD:02498" /db_xref="MIM:600040" exon 1..103 /gene="BAX" /gene_synonym="BCL2L4" /inference="alignment:Splign:1.39.8" variation 53 /gene="BAX" /gene_synonym="BCL2L4" /replace="c" /replace="t" /db_xref="dbSNP:200532779" STS 69..502 /gene="BAX" /gene_synonym="BCL2L4" /standard_name="GDB:632822" /db_xref="UniSTS:158495" CDS 70..501 /gene="BAX" /gene_synonym="BCL2L4" /note="isoform delta is encoded by transcript variant delta; apoptosis regulator BAX; bcl2-L-4; bcl-2-like protein 4; BCL2-associated X protein omega; BCL2-associated X protein transcript variant delta2" /codon_start=1 /product="apoptosis regulator BAX isoform delta" /protein_id="NP_620118.1" /db_xref="GI:20631964" /db_xref="CCDS:CCDS12743.1" /db_xref="GeneID:581" /db_xref="HGNC:959" /db_xref="HPRD:02498" /db_xref="MIM:600040" /translation="
MDGSGEQPRGGGPTSSEQIMKTGALLLQGMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
" misc_feature 82..498 /gene="BAX" /gene_synonym="BCL2L4" /note="apoptosis regulator; Region: bcl-2; TIGR00865" /db_xref="CDD:233158" misc_feature <169..414 /gene="BAX" /gene_synonym="BCL2L4" /note="Apoptosis regulator proteins of the Bcl-2 family, named after B-cell lymphoma 2. This alignment model spans what have been described as Bcl-2 homology regions BH1, BH2, BH3, and BH4. Many members of this family have an additional C-terminal transmembrane...; Region: Bcl-2_like; cd06845" /db_xref="CDD:132900" misc_feature order(190..195,202..207,214..219,238..240,244..249, 253..258,268..270,280..282,412..414) /gene="BAX" /gene_synonym="BCL2L4" /note="BH3-homology region binding site; other site" /db_xref="CDD:132900" misc_feature order(214..222,235..273) /gene="BAX" /gene_synonym="BCL2L4" /note="BH1; other site" /db_xref="CDD:132900" misc_feature 370..414 /gene="BAX" /gene_synonym="BCL2L4" /note="BH2; other site" /db_xref="CDD:132900" variation 95 /gene="BAX" /gene_synonym="BCL2L4" /replace="a" /replace="g" /db_xref="dbSNP:74422693" exon 104..155 /gene="BAX" /gene_synonym="BCL2L4" /inference="alignment:Splign:1.39.8" variation 105 /gene="BAX" /gene_synonym="BCL2L4" /replace="a" /replace="g" /db_xref="dbSNP:200327680" variation 106..107 /gene="BAX" /gene_synonym="BCL2L4" /replace="" /replace="c" /db_xref="dbSNP:67198826" STS 110..501 /gene="BAX" /gene_synonym="BCL2L4" /standard_name="PMC114802P1" /db_xref="UniSTS:270279" variation 110 /gene="BAX" /gene_synonym="BCL2L4" /replace="c" /replace="t" /db_xref="dbSNP:144179827" variation 112 /gene="BAX" /gene_synonym="BCL2L4" /replace="a" /replace="g" /db_xref="dbSNP:151036634" STS 117..466 /gene="BAX" /gene_synonym="BCL2L4" /standard_name="BARC0009" /db_xref="UniSTS:255299" variation 125 /gene="BAX" /gene_synonym="BCL2L4" /replace="a" /replace="t" /db_xref="dbSNP:374123839" variation 138 /gene="BAX" /gene_synonym="BCL2L4" /replace="a" /replace="g" /db_xref="dbSNP:140986746" exon 156..291 /gene="BAX" /gene_synonym="BCL2L4" /inference="alignment:Splign:1.39.8" variation 168 /gene="BAX" /gene_synonym="BCL2L4" /replace="c" /replace="g" /db_xref="dbSNP:370634054" variation 186 /gene="BAX" /gene_synonym="BCL2L4" /replace="c" /replace="g" /db_xref="dbSNP:374052135" variation 188 /gene="BAX" /gene_synonym="BCL2L4" /replace="a" /replace="g" /db_xref="dbSNP:202190487" variation 228 /gene="BAX" /gene_synonym="BCL2L4" /replace="c" /replace="t" /db_xref="dbSNP:148204524" variation 241 /gene="BAX" /gene_synonym="BCL2L4" /replace="a" /replace="t" /db_xref="dbSNP:367558446" variation 255 /gene="BAX" /gene_synonym="BCL2L4" /replace="c" /replace="t" /db_xref="dbSNP:201578495" variation 260..261 /gene="BAX" /gene_synonym="BCL2L4" /replace="" /replace="t" /db_xref="dbSNP:66527050" exon 292..396 /gene="BAX" /gene_synonym="BCL2L4" /inference="alignment:Splign:1.39.8" variation 292 /gene="BAX" /gene_synonym="BCL2L4" /replace="a" /replace="g" /db_xref="dbSNP:376997564" variation 311 /gene="BAX" /gene_synonym="BCL2L4" /replace="c" /replace="t" /db_xref="dbSNP:369660551" variation 312 /gene="BAX" /gene_synonym="BCL2L4" /replace="a" /replace="g" /db_xref="dbSNP:371947281" variation 322 /gene="BAX" /gene_synonym="BCL2L4" /replace="a" /replace="g" /db_xref="dbSNP:375291870" variation 323 /gene="BAX" /gene_synonym="BCL2L4" /replace="c" /replace="g" /db_xref="dbSNP:369570399" variation 355 /gene="BAX" /gene_synonym="BCL2L4" /replace="c" /replace="t" /db_xref="dbSNP:372506919" variation 361 /gene="BAX" /gene_synonym="BCL2L4" /replace="c" /replace="t" /db_xref="dbSNP:375752615" variation 362 /gene="BAX" /gene_synonym="BCL2L4" /replace="a" /replace="g" /db_xref="dbSNP:190602136" exon 397..663 /gene="BAX" /gene_synonym="BCL2L4" /inference="alignment:Splign:1.39.8" variation 399 /gene="BAX" /gene_synonym="BCL2L4" /replace="c" /replace="t" /db_xref="dbSNP:146366710" STS 411..502 /gene="BAX" /gene_synonym="BCL2L4" /standard_name="RH47233" /db_xref="UniSTS:35847" variation 417 /gene="BAX" /gene_synonym="BCL2L4" /replace="c" /replace="t" /db_xref="dbSNP:369789011" variation 422 /gene="BAX" /gene_synonym="BCL2L4" /replace="a" /replace="c" /db_xref="dbSNP:369285586" variation 423 /gene="BAX" /gene_synonym="BCL2L4" /replace="a" /replace="g" /db_xref="dbSNP:373493221" variation 439 /gene="BAX" /gene_synonym="BCL2L4" /replace="a" /replace="g" /db_xref="dbSNP:377294979" variation 474 /gene="BAX" /gene_synonym="BCL2L4" /replace="a" /replace="g" /db_xref="dbSNP:1057369" variation 492 /gene="BAX" /gene_synonym="BCL2L4" /replace="g" /replace="t" /db_xref="dbSNP:370817149" variation 579 /gene="BAX" /gene_synonym="BCL2L4" /replace="a" /replace="g" /db_xref="dbSNP:704243" variation 615..616 /gene="BAX" /gene_synonym="BCL2L4" /replace="" /replace="g" /db_xref="dbSNP:72215802" variation 619 /gene="BAX" /gene_synonym="BCL2L4" /replace="a" /replace="g" /db_xref="dbSNP:373416805" polyA_signal 642..647 /gene="BAX" /gene_synonym="BCL2L4" polyA_site 663 /gene="BAX" /gene_synonym="BCL2L4" ORIGIN
tcacgtgacccgggcgcgctgcggccgcccgcgcggacccggcgagaggcggcggcgggagcggcggtgatggacgggtccggggagcagcccagaggcggggggcccaccagctctgagcagatcatgaagacaggggcccttttgcttcaggggatgattgccgccgtggacacagactccccccgagaggtctttttccgagtggcagctgacatgttttctgacggcaacttcaactggggccgggttgtcgcccttttctactttgccagcaaactggtgctcaaggccctgtgcaccaaggtgccggaactgatcagaaccatcatgggctggacattggacttcctccgggagcggctgttgggctggatccaagaccagggtggttgggacggcctcctctcctactttgggacgcccacgtggcagaccgtgaccatctttgtggcgggagtgctcaccgcctcactcaccatctggaagaagatgggctgaggcccccagctgccttggactgtgtttttcctccataaattatggcatttttctgggaggggtggggattgggggacgtgggcatttttcttacttttgtaattattggggggtgtggggaagagtggtcttgagggggtaataaacctccttcgggacacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:581 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:581 -> Molecular function: GO:0008289 [lipid binding] evidence: IDA GeneID:581 -> Molecular function: GO:0015267 [channel activity] evidence: IDA GeneID:581 -> Molecular function: GO:0042802 [identical protein binding] evidence: IPI GeneID:581 -> Molecular function: GO:0042803 [protein homodimerization activity] evidence: IDA GeneID:581 -> Molecular function: GO:0042803 [protein homodimerization activity] evidence: IPI GeneID:581 -> Molecular function: GO:0046982 [protein heterodimerization activity] evidence: IPI GeneID:581 -> Molecular function: GO:0051434 [BH3 domain binding] evidence: IDA GeneID:581 -> Molecular function: GO:0051434 [BH3 domain binding] evidence: IPI GeneID:581 -> Biological process: GO:0001101 [response to acid] evidence: IEA GeneID:581 -> Biological process: GO:0001541 [ovarian follicle development] evidence: IEA GeneID:581 -> Biological process: GO:0001764 [neuron migration] evidence: IEA GeneID:581 -> Biological process: GO:0001777 [T cell homeostatic proliferation] evidence: IEA GeneID:581 -> Biological process: GO:0001782 [B cell homeostasis] evidence: IEA GeneID:581 -> Biological process: GO:0001783 [B cell apoptotic process] evidence: IDA GeneID:581 -> Biological process: GO:0001822 [kidney development] evidence: IEA GeneID:581 -> Biological process: GO:0001836 [release of cytochrome c from mitochondria] evidence: IDA GeneID:581 -> Biological process: GO:0001844 [protein insertion into mitochondrial membrane involved in apoptotic signaling pathway] evidence: IEA GeneID:581 -> Biological process: GO:0001974 [blood vessel remodeling] evidence: IEA GeneID:581 -> Biological process: GO:0002262 [myeloid cell homeostasis] evidence: IEA GeneID:581 -> Biological process: GO:0002352 [B cell negative selection] evidence: IEA GeneID:581 -> Biological process: GO:0002358 [B cell homeostatic proliferation] evidence: IEA GeneID:581 -> Biological process: GO:0002904 [positive regulation of B cell apoptotic process] evidence: IEA GeneID:581 -> Biological process: GO:0006309 [apoptotic DNA fragmentation] evidence: IMP GeneID:581 -> Biological process: GO:0006687 [glycosphingolipid metabolic process] evidence: IEA GeneID:581 -> Biological process: GO:0006808 [regulation of nitrogen utilization] evidence: IEA GeneID:581 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS GeneID:581 -> Biological process: GO:0006917 [induction of apoptosis] evidence: NAS GeneID:581 -> Biological process: GO:0006919 [activation of cysteine-type endopeptidase activity involved in apoptotic process] evidence: IDA GeneID:581 -> Biological process: GO:0006919 [activation of cysteine-type endopeptidase activity involved in apoptotic process] evidence: IMP GeneID:581 -> Biological process: GO:0006922 [cleavage of lamin involved in execution phase of apoptosis] evidence: IMP GeneID:581 -> Biological process: GO:0006927 [transformed cell apoptotic process] evidence: IMP GeneID:581 -> Biological process: GO:0006974 [response to DNA damage stimulus] evidence: IEA GeneID:581 -> Biological process: GO:0007281 [germ cell development] evidence: IEA GeneID:581 -> Biological process: GO:0008053 [mitochondrial fusion] evidence: IDA GeneID:581 -> Biological process: GO:0008635 [activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c] evidence: IDA GeneID:581 -> Biological process: GO:0008637 [apoptotic mitochondrial changes] evidence: IDA GeneID:581 -> Biological process: GO:0009566 [fertilization] evidence: IEA GeneID:581 -> Biological process: GO:0009636 [response to toxic substance] evidence: IDA GeneID:581 -> Biological process: GO:0009651 [response to salt stress] evidence: IEA GeneID:581 -> Biological process: GO:0010248 [establishment or maintenance of transmembrane electrochemical gradient] evidence: IDA GeneID:581 -> Biological process: GO:0010332 [response to gamma radiation] evidence: IEA GeneID:581 -> Biological process: GO:0019048 [modulation by virus of host morphology or physiology] evidence: IEA GeneID:581 -> Biological process: GO:0021854 [hypothalamus development] evidence: IEA GeneID:581 -> Biological process: GO:0021987 [cerebral cortex development] evidence: IEA GeneID:581 -> Biological process: GO:0030264 [nuclear fragmentation involved in apoptotic nuclear change] evidence: IMP GeneID:581 -> Biological process: GO:0032091 [negative regulation of protein binding] evidence: IDA GeneID:581 -> Biological process: GO:0032461 [positive regulation of protein oligomerization] evidence: IDA GeneID:581 -> Biological process: GO:0032471 [reduction of endoplasmic reticulum calcium ion concentration] evidence: IEA GeneID:581 -> Biological process: GO:0032976 [release of matrix enzymes from mitochondria] evidence: IDA GeneID:581 -> Biological process: GO:0033137 [negative regulation of peptidyl-serine phosphorylation] evidence: IEA GeneID:581 -> Biological process: GO:0033599 [regulation of mammary gland epithelial cell proliferation] evidence: IEA GeneID:581 -> Biological process: GO:0034644 [cellular response to UV] evidence: IEA GeneID:581 -> Biological process: GO:0035108 [limb morphogenesis] evidence: IEA GeneID:581 -> Biological process: GO:0035234 [germ cell programmed cell death] evidence: IEA GeneID:581 -> Biological process: GO:0042475 [odontogenesis of dentin-containing tooth] evidence: IEA GeneID:581 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: IMP GeneID:581 -> Biological process: GO:0043496 [regulation of protein homodimerization activity] evidence: IDA GeneID:581 -> Biological process: GO:0043497 [regulation of protein heterodimerization activity] evidence: IPI GeneID:581 -> Biological process: GO:0043524 [negative regulation of neuron apoptotic process] evidence: IEA GeneID:581 -> Biological process: GO:0043525 [positive regulation of neuron apoptotic process] evidence: IDA GeneID:581 -> Biological process: GO:0043653 [mitochondrial fragmentation involved in apoptotic process] evidence: IDA GeneID:581 -> Biological process: GO:0045136 [development of secondary sexual characteristics] evidence: IEA GeneID:581 -> Biological process: GO:0046666 [retinal cell programmed cell death] evidence: IEA GeneID:581 -> Biological process: GO:0048087 [positive regulation of developmental pigmentation] evidence: IEA GeneID:581 -> Biological process: GO:0048147 [negative regulation of fibroblast proliferation] evidence: IEA GeneID:581 -> Biological process: GO:0048515 [spermatid differentiation] evidence: IEA GeneID:581 -> Biological process: GO:0048597 [post-embryonic camera-type eye morphogenesis] evidence: IEA GeneID:581 -> Biological process: GO:0048678 [response to axon injury] evidence: IEA GeneID:581 -> Biological process: GO:0048873 [homeostasis of number of cells within a tissue] evidence: IEA GeneID:581 -> Biological process: GO:0051259 [protein oligomerization] evidence: IDA GeneID:581 -> Biological process: GO:0051260 [protein homooligomerization] evidence: IDA GeneID:581 -> Biological process: GO:0051281 [positive regulation of release of sequestered calcium ion into cytosol] evidence: IEA GeneID:581 -> Biological process: GO:0051402 [neuron apoptotic process] evidence: IEA GeneID:581 -> Biological process: GO:0051726 [regulation of cell cycle] evidence: IEA GeneID:581 -> Biological process: GO:0051881 [regulation of mitochondrial membrane potential] evidence: IDA GeneID:581 -> Biological process: GO:0060011 [Sertoli cell proliferation] evidence: IEA GeneID:581 -> Biological process: GO:0060041 [retina development in camera-type eye] evidence: IEA GeneID:581 -> Biological process: GO:0060058 [positive regulation of apoptotic process involved in mammary gland involution] evidence: IEA GeneID:581 -> Biological process: GO:0060068 [vagina development] evidence: IEA GeneID:581 -> Biological process: GO:0070059 [intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress] evidence: IMP GeneID:581 -> Biological process: GO:0071310 [cellular response to organic substance] evidence: IEA GeneID:581 -> Biological process: GO:0090200 [positive regulation of release of cytochrome c from mitochondria] evidence: IDA GeneID:581 -> Biological process: GO:0097190 [apoptotic signaling pathway] evidence: IDA GeneID:581 -> Biological process: GO:0097191 [extrinsic apoptotic signaling pathway] evidence: IDA GeneID:581 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: IDA GeneID:581 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: TAS GeneID:581 -> Biological process: GO:1900103 [positive regulation of endoplasmic reticulum unfolded protein response] evidence: IMP GeneID:581 -> Biological process: GO:1901030 [positive regulation of mitochondrial outer membrane permeabilization] evidence: TAS GeneID:581 -> Biological process: GO:1990009 [retinal cell apoptotic process] evidence: IMP GeneID:581 -> Biological process: GO:2001244 [positive regulation of intrinsic apoptotic signaling pathway] evidence: IMP GeneID:581 -> Cellular component: GO:0005634 [nucleus] evidence: IMP GeneID:581 -> Cellular component: GO:0005739 [mitochondrion] evidence: IDA GeneID:581 -> Cellular component: GO:0005741 [mitochondrial outer membrane] evidence: TAS GeneID:581 -> Cellular component: GO:0005757 [mitochondrial permeability transition pore complex] evidence: IDA GeneID:581 -> Cellular component: GO:0005783 [endoplasmic reticulum] evidence: IDA GeneID:581 -> Cellular component: GO:0005789 [endoplasmic reticulum membrane] evidence: IDA GeneID:581 -> Cellular component: GO:0005829 [cytosol] evidence: IDA GeneID:581 -> Cellular component: GO:0005829 [cytosol] evidence: TAS GeneID:581 -> Cellular component: GO:0046930 [pore complex] evidence: IDA GeneID:581 -> Cellular component: GO:0097136 [Bcl-2 family protein complex] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.