2024-04-19 22:31:55, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_138730 894 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens high mobility group nucleosomal binding domain 3 (HMGN3), transcript variant 2, mRNA. ACCESSION NM_138730 VERSION NM_138730.2 GI:318067957 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 894) AUTHORS Lei,S.F., Shen,H., Yang,T.L., Guo,Y., Dong,S.S., Xu,X.H., Deng,F.Y., Tian,Q., Liu,Y.J., Liu,Y.Z., Li,J. and Deng,H.W. TITLE Genome-wide association study identifies HMGN3 locus for spine bone size variation in Chinese JOURNAL Hum. Genet. 131 (3), 463-469 (2012) PUBMED 21947420 REMARK GeneRIF: The SNPs in the region of HMGN3 gene formed a tightly combined haplotype block in both Chinese and Caucasians. The results suggest that the genomic region containing HMGN3 gene may be associated with spine BS in Chinese. REFERENCE 2 (bases 1 to 894) AUTHORS Ueda,T., Furusawa,T., Kurahashi,T., Tessarollo,L. and Bustin,M. TITLE The nucleosome binding protein HMGN3 modulates the transcription profile of pancreatic beta cells and affects insulin secretion JOURNAL Mol. Cell. Biol. 29 (19), 5264-5276 (2009) PUBMED 19651901 REMARK GeneRIF: loss of HMGN3 impairs glucose-stimulated insulin secretion and leads to a diabetic phenotype. REFERENCE 3 (bases 1 to 894) AUTHORS Wu,C., Ma,M.H., Brown,K.R., Geisler,M., Li,L., Tzeng,E., Jia,C.Y., Jurisica,I. and Li,S.S. TITLE Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening JOURNAL Proteomics 7 (11), 1775-1785 (2007) PUBMED 17474147 REFERENCE 4 (bases 1 to 894) AUTHORS Leong,P.W., Liew,K., Lim,W. and Chow,V.T. TITLE Differential display RT-PCR analysis of enterovirus-71-infected rhabdomyosarcoma cells reveals mRNA expression responses of multiple human genes with known and novel functions JOURNAL Virology 295 (1), 147-159 (2002) PUBMED 12033773 REFERENCE 5 (bases 1 to 894) AUTHORS West,K.L., Ito,Y., Birger,Y., Postnikov,Y., Shirakawa,H. and Bustin,M. TITLE HMGN3a and HMGN3b, two protein isoforms with a tissue-specific expression pattern, expand the cellular repertoire of nucleosome-binding proteins JOURNAL J. Biol. Chem. 276 (28), 25959-25969 (2001) PUBMED 11356838 REFERENCE 6 (bases 1 to 894) AUTHORS Lee,J.W., Choi,H.S., Gyuris,J., Brent,R. and Moore,D.D. TITLE Two classes of proteins dependent on either the presence or absence of thyroid hormone for interaction with the thyroid hormone receptor JOURNAL Mol. Endocrinol. 9 (2), 243-254 (1995) PUBMED 7776974 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL355796.11, BC009529.2 and AY043282.1. On Jan 14, 2011 this sequence version replaced gi:23238230. Summary: Thyroid hormone receptors are hormone-dependent transcription factors that regulate expression of a variety of specific target genes. The protein encoded by this gene binds thyroid hormone receptor beta, but only in the presence of thyroid hormone. The encoded protein, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2011]. Transcript Variant: This variant (2) lacks an alternate segment in the 3' coding region compared to variant 1, which causes a frame-shift. The resulting isoform (HMGN3b) is shorter and has a distinct C-terminus compared to isoform HMGN3a. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: BG709377.1, CF454686.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-101 AL355796.11 102886-102986 c 102-877 BC009529.2 30-805 878-894 AY043282.1 886-902 FEATURES Location/Qualifiers source 1..894 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="6" /map="6q14.1" gene 1..894 /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /note="high mobility group nucleosomal binding domain 3" /db_xref="GeneID:9324" /db_xref="HGNC:12312" /db_xref="HPRD:16062" /db_xref="MIM:604502" exon 1..193 /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /inference="alignment:Splign:1.39.8" variation complement(101) /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /replace="a" /replace="c" /db_xref="dbSNP:9361504" variation complement(160) /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /replace="c" /replace="t" /db_xref="dbSNP:376144393" CDS 179..412 /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /note="isoform HMGN3b is encoded by transcript variant 2; thyroid hormone receptor interacting protein 7; high mobility group nucleosome-binding domain-containing protein 3; TR-interacting protein 7" /codon_start=1 /product="high mobility group nucleosome-binding domain-containing protein 3 isoform HMGN3b" /protein_id="NP_620058.1" /db_xref="GI:23238231" /db_xref="CCDS:CCDS4989.1" /db_xref="GeneID:9324" /db_xref="HGNC:12312" /db_xref="HPRD:16062" /db_xref="MIM:604502" /translation="
MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTEN
" misc_feature 194..196 /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (Q15651.2); phosphorylation site" misc_feature 206..208 /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /experiment="experimental evidence, no additional details recorded" /note="Phosphothreonine; propagated from UniProtKB/Swiss-Prot (Q15651.2); phosphorylation site" misc_feature 206..208 /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" exon 194..244 /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /inference="alignment:Splign:1.39.8" variation complement(212) /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /replace="a" /replace="g" /db_xref="dbSNP:113419539" exon 245..274 /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /inference="alignment:Splign:1.39.8" variation complement(256) /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /replace="a" /replace="g" /db_xref="dbSNP:114465555" variation complement(260) /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /replace="a" /replace="g" /db_xref="dbSNP:201661342" exon 275..325 /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /inference="alignment:Splign:1.39.8" variation complement(301) /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /replace="c" /replace="t" /db_xref="dbSNP:140809230" variation complement(320) /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /replace="c" /replace="g" /db_xref="dbSNP:139595568" exon 326..398 /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /inference="alignment:Splign:1.39.8" variation complement(363) /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /replace="a" /replace="g" /db_xref="dbSNP:61755716" variation complement(368) /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /replace="a" /replace="g" /db_xref="dbSNP:200614084" variation complement(383) /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /replace="a" /replace="g" /db_xref="dbSNP:371608885" exon 399..880 /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /inference="alignment:Splign:1.39.8" variation complement(425) /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /replace="c" /replace="t" /db_xref="dbSNP:370315630" variation complement(428) /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /replace="a" /replace="g" /db_xref="dbSNP:182681016" variation complement(537) /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /replace="c" /replace="t" /db_xref="dbSNP:199768088" variation complement(552) /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /replace="c" /replace="t" /db_xref="dbSNP:9448657" variation complement(565) /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /replace="a" /replace="g" /db_xref="dbSNP:147596321" STS 650..855 /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /standard_name="HSC2GA122" /db_xref="UniSTS:80944" variation complement(652) /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /replace="c" /replace="t" /db_xref="dbSNP:34043789" variation complement(699) /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /replace="a" /replace="g" /db_xref="dbSNP:145115667" variation complement(807) /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /replace="a" /replace="g" /db_xref="dbSNP:373201970" polyA_signal 855..860 /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" variation complement(875) /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" /replace="a" /replace="g" /db_xref="dbSNP:192168635" polyA_site 880 /gene="HMGN3" /gene_synonym="PNAS-24; PNAS-25; TRIP7" ORIGIN
ggagcagcagggaggcgagcagagggcccccagagggagccgcggaggtgcaggtcgaagaggccgggctacgtcgtgccctgcgcgtgagcagctgcagaggcagaggcagcatccagcggcggcgccagcagttccagtccgttgctttactttttgcttcaccgacatagtcattatgccgaagagaaagtctccagagaatacagagggcaaagatggatccaaagtaactaaacaggagcccacaagacggtctgccagattgtcagcgaaacctgctccaccaaaacctgaacccaaaccaagaaaaacatctgctaagaaagaacctggagcaaagattagcagaggtgctaaagggaagaaggaggaaaagcaggaagctggaaaggaaggcacagaaaactgaatctgtagataacgagggagaatgaattgtcatgaaaaattggggttgattttatgtatctcttgggacaacttttaaaagctatttttaccaagtattttgtaaatgctaattttttaggactctactagttggcatacgaaaatatataaggatggacattttatcgtctcatagtcatgctttttggaaatttacatcatcctcaagtaaaataaatatcagttaaatattggaagctgtgtgtaagattgattcagcattccatgcacttgctttaaaatttagtcctgtgcatactgtggtgtttttactgtgcatatttgaatttttcatgcagtttttctagagcaataatcagtggtgcttttgtacctaggttttatgtgattttaatgaaacatggatagttgtggccacctgctgactatttgtggtttaaaataaaaggtttacttgtctgcagaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:9324 -> Molecular function: GO:0031492 [nucleosomal DNA binding] evidence: IEA GeneID:9324 -> Molecular function: GO:0046966 [thyroid hormone receptor binding] evidence: NAS GeneID:9324 -> Biological process: GO:0008150 [biological_process] evidence: ND GeneID:9324 -> Biological process: GO:0016568 [chromatin modification] evidence: IEA GeneID:9324 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IEA GeneID:9324 -> Biological process: GO:0051091 [positive regulation of sequence-specific DNA binding transcription factor activity] evidence: IEA GeneID:9324 -> Biological process: GO:0061178 [regulation of insulin secretion involved in cellular response to glucose stimulus] evidence: IEA GeneID:9324 -> Cellular component: GO:0000785 [chromatin] evidence: IEA GeneID:9324 -> Cellular component: GO:0005634 [nucleus] evidence: IDA GeneID:9324 -> Cellular component: GO:0005634 [nucleus] evidence: NAS GeneID:9324 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA GeneID:9324 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.