Home |
Help |
Advanced search
2024-04-20 18:26:36, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_138723 1930 bp mRNA linear PRI 26-MAY-2013
DEFINITION Homo sapiens BCL2-like 14 (apoptosis facilitator) (BCL2L14),
transcript variant 4, mRNA.
ACCESSION NM_138723
VERSION NM_138723.1 GI:21040329
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1930)
AUTHORS Al-Shehhi,H., Konn,Z.J., Schwab,C.J., Erhorn,A., Barber,K.E.,
Wright,S.L., Gabriel,A.S., Harrison,C.J. and Moorman,A.V.
TITLE Abnormalities of the der(12)t(12;21) in ETV6-RUNX1 acute
lymphoblastic leukemia
JOURNAL Genes Chromosomes Cancer 52 (2), 202-213 (2013)
PUBMED 23077088
REMARK GeneRIF: Data indicate that LRP6, BCL2L14, DUSP16, CREBL2, and
CDKN1B were involed in centromeric (12p11.21-12p13.2) deletion in
ETV6-RUNX1 B-cell precursor acute lymphoblastic leukemia (BCP-ALL).
REFERENCE 2 (bases 1 to 1930)
AUTHORS Spitz,M.R., Gorlov,I.P., Dong,Q., Wu,X., Chen,W., Chang,D.W.,
Etzel,C.J., Caporaso,N.E., Zhao,Y., Christiani,D.C., Brennan,P.,
Albanes,D., Shi,J., Thun,M., Landi,M.T. and Amos,C.I.
TITLE Multistage analysis of variants in the inflammation pathway and
lung cancer risk in smokers
JOURNAL Cancer Epidemiol. Biomarkers Prev. 21 (7), 1213-1221 (2012)
PUBMED 22573796
REMARK GeneRIF: Single nucleotide polymorphism in BCL2L14 is associated
with lung cancer.
REFERENCE 3 (bases 1 to 1930)
AUTHORS Pickard,M.R., Mourtada-Maarabouni,M. and Williams,G.T.
TITLE Candidate tumour suppressor Fau regulates apoptosis in human cells:
an essential role for Bcl-G
JOURNAL Biochim. Biophys. Acta 1812 (9), 1146-1153 (2011)
PUBMED 21550398
REMARK GeneRIF: prior knockdown of Bcl-G expression ablates the
stimulation of basal apoptosis by FAU, consistent with an essential
downstream role for Bcl-G, itself a candidate tumour suppressor, in
mediating the apoptosis regulatory role of FAU.
REFERENCE 4 (bases 1 to 1930)
AUTHORS Kelly,J.L., Novak,A.J., Fredericksen,Z.S., Liebow,M., Ansell,S.M.,
Dogan,A., Wang,A.H., Witzig,T.E., Call,T.G., Kay,N.E.,
Habermann,T.M., Slager,S.L. and Cerhan,J.R.
TITLE Germline variation in apoptosis pathway genes and risk of
non-Hodgkin's lymphoma
JOURNAL Cancer Epidemiol. Biomarkers Prev. 19 (11), 2847-2858 (2010)
PUBMED 20855536
REMARK GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
REFERENCE 5 (bases 1 to 1930)
AUTHORS Liu,X., Pan,Z., Zhang,L., Sun,Q., Wan,J., Tian,C., Xing,G.,
Yang,J., Liu,X., Jiang,J. and He,F.
TITLE JAB1 accelerates mitochondrial apoptosis by interaction with
proapoptotic BclGs
JOURNAL Cell. Signal. 20 (1), 230-240 (2008)
PUBMED 18006276
REMARK GeneRIF: JAB1 is involved in the regulation of mitochondrial
apoptotic pathway through specific interaction with BclGs.
REFERENCE 6 (bases 1 to 1930)
AUTHORS Montpetit,A., Larose,J., Boily,G., Langlois,S., Trudel,N. and
Sinnett,D.
TITLE Mutational and expression analysis of the chromosome 12p candidate
tumor suppressor genes in pre-B acute lymphoblastic leukemia
JOURNAL Leukemia 18 (9), 1499-1504 (2004)
PUBMED 15284860
REFERENCE 7 (bases 1 to 1930)
AUTHORS Kutsenko,A.S., Gizatullin,R.Z., Al-Amin,A.N., Wang,F., Kvasha,S.M.,
Podowski,R.M., Matushkin,Y.G., Gyanchandani,A., Muravenko,O.V.,
Levitsky,V.G., Kolchanov,N.A., Protopopov,A.I., Kashuba,V.I.,
Kisselev,L.L., Wasserman,W., Wahlestedt,C. and Zabarovsky,E.R.
TITLE NotI flanking sequences: a tool for gene discovery and verification
of the human genome
JOURNAL Nucleic Acids Res. 30 (14), 3163-3170 (2002)
PUBMED 12136098
REFERENCE 8 (bases 1 to 1930)
AUTHORS Montpetit,A., Boily,G. and Sinnett,D.
TITLE A detailed transcriptional map of the chromosome 12p12 tumour
suppressor locus
JOURNAL Eur. J. Hum. Genet. 10 (1), 62-71 (2002)
PUBMED 11896457
REFERENCE 9 (bases 1 to 1930)
AUTHORS Ozalp,S.S., Yalcin,O.T., Tanir,H.M., Dundar,E. and Yildirim,S.
TITLE Bcl-2 expression in preinvasive and invasive cervical lesions
JOURNAL Eur. J. Gynaecol. Oncol. 23 (5), 419-422 (2002)
PUBMED 12440815
REFERENCE 10 (bases 1 to 1930)
AUTHORS Guo,B., Godzik,A. and Reed,J.C.
TITLE Bcl-G, a novel pro-apoptotic member of the Bcl-2 family
JOURNAL J. Biol. Chem. 276 (4), 2780-2785 (2001)
PUBMED 11054413
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BC025778.1.
This sequence is a reference standard in the RefSeqGene project.
Summary: The protein encoded by this gene belongs to the BCL2
protein family. BCL2 family members form hetero- or homodimers and
act as anti- or pro-apoptotic regulators that are involved in a
wide variety of cellular activities. Overexpression of this gene
has been shown to induce apoptosis in cells. Three alternatively
spliced transcript variants encoding two distinct isoforms have
been reported for this gene. [provided by RefSeq, May 2009].
Transcript Variant: This variant (4) contains a distinct 5' UTR
region, and encodes the identical isoform (1), when compared to
variant 1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC025778.1, AK223415.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025094 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
FEATURES Location/Qualifiers
source 1..1930
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="12"
/map="12p13-p12"
gene 1..1930
/gene="BCL2L14"
/gene_synonym="BCLG"
/note="BCL2-like 14 (apoptosis facilitator)"
/db_xref="GeneID:79370"
/db_xref="HGNC:16657"
/db_xref="MIM:606126"
exon 1..194
/gene="BCL2L14"
/gene_synonym="BCLG"
/inference="alignment:Splign:1.39.8"
misc_feature 1..191
/gene="BCL2L14"
/gene_synonym="BCLG"
/note="Region: the 5' UTR region different from variant 1"
variation 70
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="g"
/db_xref="dbSNP:143517756"
variation 112
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:145895223"
misc_feature 154..156
/gene="BCL2L14"
/gene_synonym="BCLG"
/note="upstream in-frame stop codon"
variation 177
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:80292996"
exon 195..634
/gene="BCL2L14"
/gene_synonym="BCLG"
/inference="alignment:Splign:1.39.8"
CDS 202..1185
/gene="BCL2L14"
/gene_synonym="BCLG"
/note="isoform 1 is encoded by transcript variant 4;
apoptosis regulator BCL-G; apoptosis facilitator
Bcl-2-like protein 14; bcl2-L-14"
/codon_start=1
/product="apoptosis facilitator Bcl-2-like protein 14
isoform 1"
/protein_id="NP_620049.1"
/db_xref="GI:21040330"
/db_xref="CCDS:CCDS8645.1"
/db_xref="GeneID:79370"
/db_xref="HGNC:16657"
/db_xref="MIM:606126"
/translation="
MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD
"
misc_feature 754..1158
/gene="BCL2L14"
/gene_synonym="BCLG"
/note="Apoptosis regulator proteins of the Bcl-2 family,
named after B-cell lymphoma 2. This alignment model spans
what have been described as Bcl-2 homology regions BH1,
BH2, BH3, and BH4. Many members of this family have an
additional C-terminal transmembrane...; Region:
Bcl-2_like; cl02575"
/db_xref="CDD:207655"
misc_feature 835..879
/gene="BCL2L14"
/gene_synonym="BCLG"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q9BZR8.1);
Region: BH3"
misc_feature 847..873
/gene="BCL2L14"
/gene_synonym="BCLG"
/note="BH3; other site"
/db_xref="CDD:132900"
misc_feature order(856..861,865..870,880..882,931..936,943..948,
955..960,1000..1002,1006..1011,1015..1020,1033..1035,
1045..1047)
/gene="BCL2L14"
/gene_synonym="BCLG"
/note="BH3-homology region binding site; other site"
/db_xref="CDD:132900"
misc_feature order(955..963,997..1023,1027..1038)
/gene="BCL2L14"
/gene_synonym="BCLG"
/note="BH1; other site"
/db_xref="CDD:132900"
misc_feature 1120..1158
/gene="BCL2L14"
/gene_synonym="BCLG"
/note="BH2; other site"
/db_xref="CDD:132900"
misc_feature 1123..1146
/gene="BCL2L14"
/gene_synonym="BCLG"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q9BZR8.1);
Region: BH2"
variation 209
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="g"
/replace="t"
/db_xref="dbSNP:59599134"
variation 219
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="g"
/db_xref="dbSNP:139406698"
variation 245
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:61733244"
variation 247
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="g"
/db_xref="dbSNP:370415348"
variation 266
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:61733245"
variation 282
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:61733246"
variation 283
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:142096906"
variation 301
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:141156172"
variation 356
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:376083367"
variation 358
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:142250889"
variation 368
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:371514083"
variation 372
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:374164865"
variation 383
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="g"
/db_xref="dbSNP:368530005"
variation 408
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:61733247"
variation 415
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:140584428"
variation 509
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:371624447"
variation 516
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:138260830"
variation 517
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:376032131"
variation 525
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:186696253"
variation 528
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="g"
/replace="t"
/db_xref="dbSNP:367663061"
variation 551
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:141892443"
variation 557
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:149592138"
variation 595
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="c"
/db_xref="dbSNP:3815568"
variation 609
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:61729499"
variation 610
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:200779523"
variation 628
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="c"
/db_xref="dbSNP:372836511"
exon 635..808
/gene="BCL2L14"
/gene_synonym="BCLG"
/inference="alignment:Splign:1.39.8"
variation 646
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="g"
/replace="t"
/db_xref="dbSNP:2416948"
variation 658
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:138853585"
variation 687
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:879732"
variation 770..771
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace=""
/replace="c"
/db_xref="dbSNP:36104369"
variation 773
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:113665428"
variation 782
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:375463687"
variation 785
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:369864408"
variation 787
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:17819796"
variation 788
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="t"
/db_xref="dbSNP:139476893"
variation 789
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:139420279"
exon 809..879
/gene="BCL2L14"
/gene_synonym="BCLG"
/inference="alignment:Splign:1.39.8"
variation 814
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:141761714"
variation 825
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:150568064"
exon 880..1146
/gene="BCL2L14"
/gene_synonym="BCLG"
/inference="alignment:Splign:1.39.8"
variation 898
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:11054683"
variation 948
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="g"
/db_xref="dbSNP:370468556"
variation 976
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="c"
/db_xref="dbSNP:61738409"
variation 983
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:148640639"
variation 1002
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:139549265"
variation 1031
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:202089461"
variation 1032
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="c"
/db_xref="dbSNP:145041635"
variation 1033
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:147550863"
variation 1038
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:61753207"
variation 1039
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:201867584"
variation 1075
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="t"
/db_xref="dbSNP:61739220"
variation 1095
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:367766873"
variation 1118
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:73053321"
variation 1131
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:372228342"
exon 1147..1892
/gene="BCL2L14"
/gene_synonym="BCLG"
/inference="alignment:Splign:1.39.8"
variation 1191
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="g"
/db_xref="dbSNP:376810924"
variation 1213
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="g"
/db_xref="dbSNP:368337681"
variation 1305
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:150017586"
variation 1325
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:369077886"
variation 1341
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="g"
/replace="t"
/db_xref="dbSNP:1797647"
variation 1344
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:185276807"
variation 1376
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="g"
/replace="t"
/db_xref="dbSNP:367916967"
STS 1411..1560
/gene="BCL2L14"
/gene_synonym="BCLG"
/standard_name="WI-16673"
/db_xref="UniSTS:71275"
variation 1523
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="t"
/db_xref="dbSNP:146725411"
variation 1540
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:140363991"
variation 1576
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:201488916"
variation 1790
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace=""
/replace="c"
/db_xref="dbSNP:370512417"
polyA_signal 1863..1868
/gene="BCL2L14"
/gene_synonym="BCLG"
variation 1873
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:190517309"
polyA_site 1892
/gene="BCL2L14"
/gene_synonym="BCLG"
/experiment="experimental evidence, no additional details
recorded"
ORIGIN
ttcaggctgagtcctaaacctgaagaaagtttagagcctggggctctaaactacctgagtctttccaaacgacaagccaagaagacctgttgaaagtttcctcttaagtttcgtggagagagactcaggtatagaaatatccttactgccacctgacctgaagcagaagaaatcacagacagcttccagaccaggcccaacatgtgtagcaccagtgggtgtgacctggaagaaatccccctagatgatgatgacctaaacaccatagaattcaaaatcctcgcctactacaccagacatcatgtcttcaagagcacccctgctctcttctcaccaaagctgctgagaacaagaagtttgtcccagaggggcctggggaattgttcagcaaatgagtcatggacagaggtgtcatggccttgcagaaattcccaatccagtgagaaggccataaaccttggcaagaaaaagtcttcttggaaagcattctttggagtagtggagaaggaagattcgcagagcacgcctgccaaggtctctgctcagggtcaaaggacgttggaataccaagattcgcacagccagcagtggtccaggtgtctttctaacgtggagcagtgcttggagcatgaagctgtggaccccaaagtcatttccattgccaaccgagtagctgaaattgtttactcctggccaccaccacaagcgacccaggcaggaggcttcaagtccaaagagatttttgtaactgagggtctctccttccagctccaaggccacgtgcctgtagcttcaagttctaagaaagatgaagaagaacaaatactagccaaaattgttgagctgctgaaatattcaggagatcagttggaaagaaagctgaagaaagataaggctttgatgggccacttccaggatgggctgtcctactctgttttcaagaccatcacagaccaggtcctaatgggtgtggaccccaggggagaatcagaggtcaaagctcagggctttaaggctgcccttgtaatagacgtcacggccaagctcacagctattgacaaccacccgatgaacagggtcctgggctttggcaccaagtacctgaaagagaacttctcgccatggatccagcagcacggtggatgggaaaaaatacttgggatatcacatgaagaagtagactgaaatatcagatttgtcatcaggaatactctttgtctactgtggtcctgtgcacgttggcctcagatggactacaggagattacaacgtacaaggcagatggagcattgacgttttcaaaaccattattcctgtgactggagaggcatcaggagaggtctcgttcgtctccagctcataaaatgtagcagcatcatccttgacagtgatgtttttcaggccctccattgagaacctgaggaaatctgtaaagataagtggtgatgttgtttcaaacgttcagaacagataccatcatcctgcctttgttagctgctgtagggaaagtgcgttacagatgtctgctgacctcacaagagtgaaaagataaactgtgcatgtgtttccacttccgtttctagtactatttatttttaaactacacttggggtggcctaatacctaggaagatgttgctattcacgttagtaaacagcctaaagaaactcttaggtttactgctacatccatttgtttggagaggtaactgttgtctgtgcctttttgaaaaacttccatttggtacaaaatttttactccaacaccccctcaacccttttctcagggaccacacctcttcttcccaaggtccctgggacttcctcattctttgtggtagtacaatgattggtagcaggtaaaataaatacatagaaagactactgtcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:79370 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:79370 -> Molecular function: GO:0019901 [protein kinase binding] evidence: IPI
GeneID:79370 -> Biological process: GO:0006915 [apoptotic process] evidence: IDA
GeneID:79370 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: IEA
GeneID:79370 -> Biological process: GO:2001238 [positive regulation of extrinsic apoptotic signaling pathway] evidence: IDA
GeneID:79370 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:79370 -> Cellular component: GO:0005829 [cytosol] evidence: IDA
GeneID:79370 -> Cellular component: GO:0012505 [endomembrane system] evidence: IEA
GeneID:79370 -> Cellular component: GO:0016020 [membrane] evidence: IEA
GeneID:79370 -> Cellular component: GO:0043229 [intracellular organelle] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.