GGRNA Home | Help | Advanced search

2024-03-29 17:16:32, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_138722               1886 bp    mRNA    linear   PRI 26-MAY-2013
DEFINITION  Homo sapiens BCL2-like 14 (apoptosis facilitator) (BCL2L14),
            transcript variant 1, mRNA.
ACCESSION   NM_138722
VERSION     NM_138722.1  GI:21040327
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1886)
  AUTHORS   Al-Shehhi,H., Konn,Z.J., Schwab,C.J., Erhorn,A., Barber,K.E.,
            Wright,S.L., Gabriel,A.S., Harrison,C.J. and Moorman,A.V.
  TITLE     Abnormalities of the der(12)t(12;21) in ETV6-RUNX1 acute
            lymphoblastic leukemia
  JOURNAL   Genes Chromosomes Cancer 52 (2), 202-213 (2013)
   PUBMED   23077088
  REMARK    GeneRIF: Data indicate that LRP6, BCL2L14, DUSP16, CREBL2, and
            CDKN1B were involed in centromeric (12p11.21-12p13.2) deletion in
            ETV6-RUNX1 B-cell precursor acute lymphoblastic leukemia (BCP-ALL).
REFERENCE   2  (bases 1 to 1886)
  AUTHORS   Spitz,M.R., Gorlov,I.P., Dong,Q., Wu,X., Chen,W., Chang,D.W.,
            Etzel,C.J., Caporaso,N.E., Zhao,Y., Christiani,D.C., Brennan,P.,
            Albanes,D., Shi,J., Thun,M., Landi,M.T. and Amos,C.I.
  TITLE     Multistage analysis of variants in the inflammation pathway and
            lung cancer risk in smokers
  JOURNAL   Cancer Epidemiol. Biomarkers Prev. 21 (7), 1213-1221 (2012)
   PUBMED   22573796
  REMARK    GeneRIF: Single nucleotide polymorphism in BCL2L14 is associated
            with lung cancer.
REFERENCE   3  (bases 1 to 1886)
  AUTHORS   Pickard,M.R., Mourtada-Maarabouni,M. and Williams,G.T.
  TITLE     Candidate tumour suppressor Fau regulates apoptosis in human cells:
            an essential role for Bcl-G
  JOURNAL   Biochim. Biophys. Acta 1812 (9), 1146-1153 (2011)
   PUBMED   21550398
  REMARK    GeneRIF: prior knockdown of Bcl-G expression ablates the
            stimulation of basal apoptosis by FAU, consistent with an essential
            downstream role for Bcl-G, itself a candidate tumour suppressor, in
            mediating the apoptosis regulatory role of FAU.
REFERENCE   4  (bases 1 to 1886)
  AUTHORS   Kelly,J.L., Novak,A.J., Fredericksen,Z.S., Liebow,M., Ansell,S.M.,
            Dogan,A., Wang,A.H., Witzig,T.E., Call,T.G., Kay,N.E.,
            Habermann,T.M., Slager,S.L. and Cerhan,J.R.
  TITLE     Germline variation in apoptosis pathway genes and risk of
            non-Hodgkin's lymphoma
  JOURNAL   Cancer Epidemiol. Biomarkers Prev. 19 (11), 2847-2858 (2010)
   PUBMED   20855536
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   5  (bases 1 to 1886)
  AUTHORS   Liu,X., Pan,Z., Zhang,L., Sun,Q., Wan,J., Tian,C., Xing,G.,
            Yang,J., Liu,X., Jiang,J. and He,F.
  TITLE     JAB1 accelerates mitochondrial apoptosis by interaction with
            proapoptotic BclGs
  JOURNAL   Cell. Signal. 20 (1), 230-240 (2008)
   PUBMED   18006276
  REMARK    GeneRIF: JAB1 is involved in the regulation of mitochondrial
            apoptotic pathway through specific interaction with BclGs.
REFERENCE   6  (bases 1 to 1886)
  AUTHORS   Montpetit,A., Larose,J., Boily,G., Langlois,S., Trudel,N. and
            Sinnett,D.
  TITLE     Mutational and expression analysis of the chromosome 12p candidate
            tumor suppressor genes in pre-B acute lymphoblastic leukemia
  JOURNAL   Leukemia 18 (9), 1499-1504 (2004)
   PUBMED   15284860
REFERENCE   7  (bases 1 to 1886)
  AUTHORS   Kutsenko,A.S., Gizatullin,R.Z., Al-Amin,A.N., Wang,F., Kvasha,S.M.,
            Podowski,R.M., Matushkin,Y.G., Gyanchandani,A., Muravenko,O.V.,
            Levitsky,V.G., Kolchanov,N.A., Protopopov,A.I., Kashuba,V.I.,
            Kisselev,L.L., Wasserman,W., Wahlestedt,C. and Zabarovsky,E.R.
  TITLE     NotI flanking sequences: a tool for gene discovery and verification
            of the human genome
  JOURNAL   Nucleic Acids Res. 30 (14), 3163-3170 (2002)
   PUBMED   12136098
REFERENCE   8  (bases 1 to 1886)
  AUTHORS   Montpetit,A., Boily,G. and Sinnett,D.
  TITLE     A detailed transcriptional map of the chromosome 12p12 tumour
            suppressor locus
  JOURNAL   Eur. J. Hum. Genet. 10 (1), 62-71 (2002)
   PUBMED   11896457
REFERENCE   9  (bases 1 to 1886)
  AUTHORS   Ozalp,S.S., Yalcin,O.T., Tanir,H.M., Dundar,E. and Yildirim,S.
  TITLE     Bcl-2 expression in preinvasive and invasive cervical lesions
  JOURNAL   Eur. J. Gynaecol. Oncol. 23 (5), 419-422 (2002)
   PUBMED   12440815
REFERENCE   10 (bases 1 to 1886)
  AUTHORS   Guo,B., Godzik,A. and Reed,J.C.
  TITLE     Bcl-G, a novel pro-apoptotic member of the Bcl-2 family
  JOURNAL   J. Biol. Chem. 276 (4), 2780-2785 (2001)
   PUBMED   11054413
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AF281254.1.
            
            Summary: The protein encoded by this gene belongs to the BCL2
            protein family. BCL2 family members form hetero- or homodimers and
            act as anti- or pro-apoptotic regulators that are involved in a
            wide variety of cellular activities. Overexpression of this gene
            has been shown to induce apoptosis in cells. Three alternatively
            spliced transcript variants encoding two distinct isoforms have
            been reported for this gene. [provided by RefSeq, May 2009].
            
            Transcript Variant: This variant (1) is also known as BCL-G long
            form. It encodes the longest isoform (1).
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF281254.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025085 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..1886
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="12"
                     /map="12p13-p12"
     gene            1..1886
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /note="BCL2-like 14 (apoptosis facilitator)"
                     /db_xref="GeneID:79370"
                     /db_xref="HGNC:16657"
                     /db_xref="HPRD:05841"
                     /db_xref="MIM:606126"
     exon            1..188
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /inference="alignment:Splign:1.39.8"
     variation       83
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:75691667"
     misc_feature    97..99
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /note="upstream in-frame stop codon"
     variation       142
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2287154"
     variation       171
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:377313330"
     exon            189..628
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /inference="alignment:Splign:1.39.8"
     CDS             196..1179
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /note="isoform 1 is encoded by transcript variant 1;
                     apoptosis regulator BCL-G; apoptosis facilitator
                     Bcl-2-like protein 14; bcl2-L-14"
                     /codon_start=1
                     /product="apoptosis facilitator Bcl-2-like protein 14
                     isoform 1"
                     /protein_id="NP_620048.1"
                     /db_xref="GI:21040328"
                     /db_xref="CCDS:CCDS8645.1"
                     /db_xref="GeneID:79370"
                     /db_xref="HGNC:16657"
                     /db_xref="HPRD:05841"
                     /db_xref="MIM:606126"
                     /translation="
MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD
"
     misc_feature    748..1152
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /note="Apoptosis regulator proteins of the Bcl-2 family,
                     named after B-cell lymphoma 2. This alignment model spans
                     what have been described as Bcl-2 homology regions BH1,
                     BH2, BH3, and BH4. Many members of this family have an
                     additional C-terminal transmembrane...; Region:
                     Bcl-2_like; cl02575"
                     /db_xref="CDD:207655"
     misc_feature    829..873
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9BZR8.1);
                     Region: BH3"
     misc_feature    841..867
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /note="BH3; other site"
                     /db_xref="CDD:132900"
     misc_feature    order(850..855,859..864,874..876,925..930,937..942,
                     949..954,994..996,1000..1005,1009..1014,1027..1029,
                     1039..1041)
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /note="BH3-homology region binding site; other site"
                     /db_xref="CDD:132900"
     misc_feature    order(949..957,991..1017,1021..1032)
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /note="BH1; other site"
                     /db_xref="CDD:132900"
     misc_feature    1114..1152
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /note="BH2; other site"
                     /db_xref="CDD:132900"
     misc_feature    1117..1140
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9BZR8.1);
                     Region: BH2"
     variation       203
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:59599134"
     variation       213
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:139406698"
     variation       239
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61733244"
     variation       241
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370415348"
     variation       260
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61733245"
     variation       276
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61733246"
     variation       277
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142096906"
     variation       295
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141156172"
     variation       350
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376083367"
     variation       352
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142250889"
     variation       362
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371514083"
     variation       366
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374164865"
     variation       377
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:368530005"
     variation       402
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61733247"
     variation       409
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140584428"
     variation       503
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371624447"
     variation       510
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138260830"
     variation       511
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376032131"
     variation       519
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186696253"
     variation       522
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:367663061"
     variation       545
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141892443"
     variation       551
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149592138"
     variation       589
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:3815568"
     variation       603
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61729499"
     variation       604
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200779523"
     variation       622
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:372836511"
     exon            629..802
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /inference="alignment:Splign:1.39.8"
     variation       640
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2416948"
     variation       652
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138853585"
     variation       681
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:879732"
     variation       764..765
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:36104369"
     variation       767
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113665428"
     variation       776
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375463687"
     variation       779
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369864408"
     variation       781
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:17819796"
     variation       782
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:139476893"
     variation       783
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139420279"
     exon            803..873
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /inference="alignment:Splign:1.39.8"
     variation       808
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141761714"
     variation       819
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150568064"
     exon            874..1140
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /inference="alignment:Splign:1.39.8"
     variation       892
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11054683"
     variation       942
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370468556"
     variation       970
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:61738409"
     variation       977
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148640639"
     variation       996
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139549265"
     variation       1025
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202089461"
     variation       1026
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:145041635"
     variation       1027
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:147550863"
     variation       1032
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61753207"
     variation       1033
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201867584"
     variation       1069
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:61739220"
     variation       1089
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367766873"
     variation       1112
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:73053321"
     variation       1125
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372228342"
     exon            1141..1886
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /inference="alignment:Splign:1.39.8"
     variation       1185
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376810924"
     variation       1207
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:368337681"
     variation       1299
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150017586"
     variation       1319
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369077886"
     variation       1335
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1797647"
     variation       1338
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185276807"
     variation       1370
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:367916967"
     STS             1405..1554
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /standard_name="WI-16673"
                     /db_xref="UniSTS:71275"
     variation       1517
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:146725411"
     variation       1534
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140363991"
     variation       1570
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201488916"
     variation       1784
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:370512417"
     polyA_signal    1857..1862
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
     variation       1867
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190517309"
     polyA_site      1886
                     /gene="BCL2L14"
                     /gene_synonym="BCLG"
                     /experiment="experimental evidence, no additional details
                     recorded"
ORIGIN      
aatgacatgacagccattccgtggccagggacaccactgcccaagctggagaccacgaggattcagggactgaagccagcatgggaattcctggtttgagatcagagtcctgagtacctcgtgggaacttgggcactcatccgcaggaggtctagacccccagagaattccttgagtctaaggcacaggcccaacatgtgtagcaccagtgggtgtgacctggaagaaatccccctagatgatgatgacctaaacaccatagaattcaaaatcctcgcctactacaccagacatcatgtcttcaagagcacccctgctctcttctcaccaaagctgctgagaacaagaagtttgtcccagaggggcctggggaattgttcagcaaatgagtcatggacagaggtgtcatggccttgcagaaattcccaatccagtgagaaggccataaaccttggcaagaaaaagtcttcttggaaagcattctttggagtagtggagaaggaagattcgcagagcacgcctgccaaggtctctgctcagggtcaaaggacgttggaataccaagattcgcacagccagcagtggtccaggtgtctttctaacgtggagcagtgcttggagcatgaagctgtggaccccaaagtcatttccattgccaaccgagtagctgaaattgtttactcctggccaccaccacaagcgacccaggcaggaggcttcaagtccaaagagatttttgtaactgagggtctctccttccagctccaaggccacgtgcctgtagcttcaagttctaagaaagatgaagaagaacaaatactagccaaaattgttgagctgctgaaatattcaggagatcagttggaaagaaagctgaagaaagataaggctttgatgggccacttccaggatgggctgtcctactctgttttcaagaccatcacagaccaggtcctaatgggtgtggaccccaggggagaatcagaggtcaaagctcagggctttaaggctgcccttgtaatagacgtcacggccaagctcacagctattgacaaccacccgatgaacagggtcctgggctttggcaccaagtacctgaaagagaacttctcgccatggatccagcagcacggtggatgggaaaaaatacttgggatatcacatgaagaagtagactgaaatatcagatttgtcatcaggaatactctttgtctactgtggtcctgtgcacgttggcctcagatggactacaggagattacaacgtacaaggcagatggagcattgacgttttcaaaaccattattcctgtgactggagaggcatcaggagaggtctcgttcgtctccagctcataaaatgtagcagcatcatccttgacagtgatgtttttcaggccctccattgagaacctgaggaaatctgtaaagataagtggtgatgttgtttcaaacgttcagaacagataccatcatcctgcctttgttagctgctgtagggaaagtgcgttacagatgtctgctgacctcacaagagtgaaaagataaactgtgcatgtgtttccacttccgtttctagtactatttatttttaaactacacttggggtggcctaatacctaggaagatgttgctattcacgttagtaaacagcctaaagaaactcttaggtttactgctacatccatttgtttggagaggtaactgttgtctgtgcctttttgaaaaacttccatttggtacaaaatttttactccaacaccccctcaacccttttctcagggaccacacctcttcttcccaaggtccctgggacttcctcattctttgtggtagtacaatgattggtagcaggtaaaataaatacatagaaagactactgtcaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:79370 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:79370 -> Molecular function: GO:0019901 [protein kinase binding] evidence: IPI
            GeneID:79370 -> Biological process: GO:0006915 [apoptotic process] evidence: IDA
            GeneID:79370 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: IEA
            GeneID:79370 -> Biological process: GO:2001238 [positive regulation of extrinsic apoptotic signaling pathway] evidence: IDA
            GeneID:79370 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
            GeneID:79370 -> Cellular component: GO:0005829 [cytosol] evidence: IDA
            GeneID:79370 -> Cellular component: GO:0012505 [endomembrane system] evidence: IEA
            GeneID:79370 -> Cellular component: GO:0016020 [membrane] evidence: IEA
            GeneID:79370 -> Cellular component: GO:0043229 [intracellular organelle] evidence: IDA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.