GGRNA Home | Help | Advanced search

2024-04-27 06:48:07, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_138454                948 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens nucleoredoxin-like 1 (NXNL1), mRNA.
ACCESSION   NM_138454
VERSION     NM_138454.1  GI:19923986
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 948)
  AUTHORS   Reichman,S., Kalathur,R.K., Lambard,S., Ait-Ali,N., Yang,Y.,
            Lardenois,A., Ripp,R., Poch,O., Zack,D.J., Sahel,J.A. and
            Leveillard,T.
  TITLE     The homeobox gene CHX10/VSX2 regulates RdCVF promoter activity in
            the inner retina
  JOURNAL   Hum. Mol. Genet. 19 (2), 250-261 (2010)
   PUBMED   19843539
  REMARK    GeneRIF: CHX10 regulates RdCVF promoter activity in the inner
            retina.
REFERENCE   2  (bases 1 to 948)
  AUTHORS   Brennan,L.A., Lee,W. and Kantorow,M.
  TITLE     TXNL6 is a novel oxidative stress-induced reducing system for
            methionine sulfoxide reductase a repair of alpha-crystallin and
            cytochrome C in the eye lens
  JOURNAL   PLoS ONE 5 (11), E15421 (2010)
   PUBMED   21079812
  REMARK    GeneRIF: Data suggest a critical role for TXNL6 in MsrA repair of
            essential lens proteins under oxidative stress conditions and that
            TXNL6 is important for MsrA defense protection against cataract.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 948)
  AUTHORS   Lambard,S., Reichman,S., Berlinicke,C., Niepon,M.L., Goureau,O.,
            Sahel,J.A., Leveillard,T. and Zack,D.J.
  TITLE     Expression of rod-derived cone viability factor: dual role of CRX
            in regulating promoter activity and cell-type specificity
  JOURNAL   PLoS ONE 5 (10), E13075 (2010)
   PUBMED   20949100
  REMARK    GeneRIF: regulation of the Nucleoredoxin-like genes involves a CRX
            responsive element that can act as both as a positive regulator of
            promoter activity and as a modulator of cell-type specificity
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 948)
  AUTHORS   Bin,J., Madhavan,J., Ferrini,W., Mok,C.A., Billingsley,G. and
            Heon,E.
  TITLE     BBS7 and TTC8 (BBS8) mutations play a minor role in the mutational
            load of Bardet-Biedl syndrome in a multiethnic population
  JOURNAL   Hum. Mutat. 30 (7), E737-E746 (2009)
   PUBMED   19402160
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   5  (bases 1 to 948)
  AUTHORS   Wang,X.W., Tan,B.Z., Sun,M., Ho,B. and Ding,J.L.
  TITLE     Thioredoxin-like 6 protects retinal cell line from photooxidative
            damage by upregulating NF-kappaB activity
  JOURNAL   Free Radic. Biol. Med. 45 (3), 336-344 (2008)
   PUBMED   18474255
  REMARK    GeneRIF: TXNL6 probably protects retinal cells from photooxidative
            damage-induced apoptosis via upregulation of NF-kappaB activity
REFERENCE   6  (bases 1 to 948)
  AUTHORS   Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z.,
            Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S.,
            McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J.,
            Dunham,I., Hill,D.E. and Vidal,M.
  TITLE     hORFeome v3.1: a resource of human open reading frames representing
            over 10,000 human genes
  JOURNAL   Genomics 89 (3), 307-315 (2007)
   PUBMED   17207965
REFERENCE   7  (bases 1 to 948)
  AUTHORS   Roni,V., Carpio,R. and Wissinger,B.
  TITLE     Mapping of transcription start sites of human retina expressed
            genes
  JOURNAL   BMC Genomics 8, 42 (2007)
   PUBMED   17286855
  REMARK    Publication Status: Online-Only
REFERENCE   8  (bases 1 to 948)
  AUTHORS   Hanein,S., Perrault,I., Gerber,S., Dollfus,H., Dufier,J.L.,
            Feingold,J., Munnich,A., Bhattacharya,S., Kaplan,J., Sahel,J.A.,
            Rozet,J.M. and Leveillard,T.
  TITLE     Disease-associated variants of the rod-derived cone viability
            factor (RdCVF) in Leber congenital amaurosis. Rod-derived cone
            viability variants in LCA
  JOURNAL   Adv. Exp. Med. Biol. 572, 9-14 (2006)
   PUBMED   17249548
  REMARK    GeneRIF: RdCVF variants have roles in leber congenital amaurosis
REFERENCE   9  (bases 1 to 948)
  AUTHORS   Leveillard,T., Mohand-Said,S., Lorentz,O., Hicks,D., Fintz,A.C.,
            Clerin,E., Simonutti,M., Forster,V., Cavusoglu,N., Chalmel,F.,
            Dolle,P., Poch,O., Lambrou,G. and Sahel,J.A.
  TITLE     Identification and characterization of rod-derived cone viability
            factor
  JOURNAL   Nat. Genet. 36 (7), 755-759 (2004)
   PUBMED   15220920
  REMARK    GeneRIF: is a truncated thioredoxin-like protein specifically
            expressed by photoreceptors. The identification of this protein
            offers new treatment possibilities for retinitis pigmentosa
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC014127.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC014127.1, BG395178.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025084 [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..948
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="19"
                     /map="19p13.11"
     gene            1..948
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /note="nucleoredoxin-like 1"
                     /db_xref="GeneID:115861"
                     /db_xref="HGNC:25179"
                     /db_xref="HPRD:12300"
                     /db_xref="MIM:608791"
     exon            1..373
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(13)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200603341"
     variation       complement(17)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371631664"
     variation       complement(36)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369023942"
     CDS             48..686
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /note="rod-derived cone viability factor; thioredoxin-like
                     6; thioredoxin-like protein 6"
                     /codon_start=1
                     /product="nucleoredoxin-like protein 1"
                     /protein_id="NP_612463.1"
                     /db_xref="GI:19923987"
                     /db_xref="CCDS:CCDS12360.1"
                     /db_xref="GeneID:115861"
                     /db_xref="HGNC:25179"
                     /db_xref="HPRD:12300"
                     /db_xref="MIM:608791"
                     /translation="
MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVRLTDEFYVLRAAQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADEIQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEKAARGGRDPGGGGGEEGGAGGLF
"
     misc_feature    69..506
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /note="Tryparedoxin (TryX)-like family, Rod-derived cone
                     viability factor (RdCVF) subfamily; RdCVF is a thioredoxin
                     (TRX)-like protein specifically expressed in
                     photoreceptors. RdCVF was isolated and identified as a
                     factor that supports cone survival in retinal...; Region:
                     TryX_like_RdCVF; cd03008"
                     /db_xref="CDD:48557"
     misc_feature    order(177..179,186..188)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:48557"
     variation       complement(48)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142316793"
     variation       complement(69)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369921727"
     variation       complement(71)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:140823542"
     variation       complement(81)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201151826"
     variation       complement(82)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376824868"
     variation       complement(83)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:147394576"
     variation       complement(92)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142835364"
     variation       complement(93)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140610859"
     variation       complement(112)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375513833"
     variation       complement(113)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199712483"
     variation       complement(114)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144177332"
     variation       complement(130)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372809923"
     variation       complement(134)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368463370"
     variation       complement(140)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:76407302"
     variation       complement(151)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:80113786"
     variation       complement(165)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:75189705"
     variation       complement(198)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374915427"
     variation       complement(221)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:137874549"
     variation       complement(225)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182137093"
     variation       complement(226)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371790764"
     variation       complement(233)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367630859"
     variation       complement(237)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150719211"
     variation       complement(243)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374980877"
     variation       complement(244)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370480285"
     variation       complement(252)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372287276"
     variation       complement(284)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:185508084"
     variation       complement(291)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368607758"
     variation       complement(295)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377352923"
     variation       complement(296)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374141772"
     variation       complement(303)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371083550"
     variation       complement(315)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78643580"
     variation       complement(320)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:138621059"
     variation       complement(322)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201992877"
     variation       complement(329)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:145106863"
     variation       complement(330)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:373380579"
     exon            374..908
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(377)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371085748"
     variation       complement(422)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:192929983"
     variation       complement(425)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:375599803"
     variation       complement(453)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372954697"
     variation       complement(455)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112314563"
     variation       complement(508)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:56248314"
     variation       complement(519)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373187772"
     variation       complement(521)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:369694146"
     variation       complement(532)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:10408265"
     variation       complement(537)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201159027"
     variation       complement(568)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201624169"
     variation       complement(580)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:56084515"
     variation       complement(733)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:56384297"
     variation       complement(785)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:187776873"
     variation       complement(869)
                     /gene="NXNL1"
                     /gene_synonym="RDCVF; TXNL6"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183371494"
ORIGIN      
ccggggaccacacgccgcgctgtccccagcacccaacccaggttaccatggcctccctgttctctggccgcatcctgatccgcaacaatagcgaccaggacgagctggatacggaggctgaggtcagtcgcaggctggagaaccggctggtgctgctgttctttggtgctggggcttgtccacagtgccaggccttcgtgcccatcctcaaggacttcttcgtgcggctcacagatgagttctatgtactgcgggcggctcagctggccctggtgtacgtgtcccaggactccacggaggagcagcaggacctgttcctcaaggacatgccaaagaaatggcttttcctgccctttgaggatgatctgaggagggacctcgggcgccagttctcagtggagcgcctgccggcggtcgtggtgctcaagccggacggggacgtgctcactcgcgacggcgccgacgagatccagcgcctgggcaccgcctgcttcgccaactggcaggaggcggccgaggtgctggaccgcaacttccagctgccagaggacctggaggaccaggagccacggagcctcaccgagtgcctgcgccgccacaagtaccgcgtggaaaaggcggcgcgaggcgggcgcgaccccgggggagggggtggggaggagggcggggccggggggctgttctgacccgctagggtggaggagaggagtggggtttgttgatgaacctccacccccaccccacccccgcacgcctgtaatcccagcacttggggaggccaaggcgggaggatcgcttgagcccagaggttcgagatcaacctgggcaagagagtgagaccctgactctacgaaaattaaaagttagcccggtgtggtggcgcgcacctgtggcttagctaccctgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:115861 -> Cellular component: GO:0005640 [nuclear outer membrane] evidence: IEA
            GeneID:115861 -> Cellular component: GO:0005739 [mitochondrion] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.