2024-04-27 06:28:25, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_138454 948 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens nucleoredoxin-like 1 (NXNL1), mRNA. ACCESSION NM_138454 VERSION NM_138454.1 GI:19923986 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 948) AUTHORS Reichman,S., Kalathur,R.K., Lambard,S., Ait-Ali,N., Yang,Y., Lardenois,A., Ripp,R., Poch,O., Zack,D.J., Sahel,J.A. and Leveillard,T. TITLE The homeobox gene CHX10/VSX2 regulates RdCVF promoter activity in the inner retina JOURNAL Hum. Mol. Genet. 19 (2), 250-261 (2010) PUBMED 19843539 REMARK GeneRIF: CHX10 regulates RdCVF promoter activity in the inner retina. REFERENCE 2 (bases 1 to 948) AUTHORS Brennan,L.A., Lee,W. and Kantorow,M. TITLE TXNL6 is a novel oxidative stress-induced reducing system for methionine sulfoxide reductase a repair of alpha-crystallin and cytochrome C in the eye lens JOURNAL PLoS ONE 5 (11), E15421 (2010) PUBMED 21079812 REMARK GeneRIF: Data suggest a critical role for TXNL6 in MsrA repair of essential lens proteins under oxidative stress conditions and that TXNL6 is important for MsrA defense protection against cataract. Publication Status: Online-Only REFERENCE 3 (bases 1 to 948) AUTHORS Lambard,S., Reichman,S., Berlinicke,C., Niepon,M.L., Goureau,O., Sahel,J.A., Leveillard,T. and Zack,D.J. TITLE Expression of rod-derived cone viability factor: dual role of CRX in regulating promoter activity and cell-type specificity JOURNAL PLoS ONE 5 (10), E13075 (2010) PUBMED 20949100 REMARK GeneRIF: regulation of the Nucleoredoxin-like genes involves a CRX responsive element that can act as both as a positive regulator of promoter activity and as a modulator of cell-type specificity Publication Status: Online-Only REFERENCE 4 (bases 1 to 948) AUTHORS Bin,J., Madhavan,J., Ferrini,W., Mok,C.A., Billingsley,G. and Heon,E. TITLE BBS7 and TTC8 (BBS8) mutations play a minor role in the mutational load of Bardet-Biedl syndrome in a multiethnic population JOURNAL Hum. Mutat. 30 (7), E737-E746 (2009) PUBMED 19402160 REMARK GeneRIF: Observational study of gene-disease association. (HuGE Navigator) REFERENCE 5 (bases 1 to 948) AUTHORS Wang,X.W., Tan,B.Z., Sun,M., Ho,B. and Ding,J.L. TITLE Thioredoxin-like 6 protects retinal cell line from photooxidative damage by upregulating NF-kappaB activity JOURNAL Free Radic. Biol. Med. 45 (3), 336-344 (2008) PUBMED 18474255 REMARK GeneRIF: TXNL6 probably protects retinal cells from photooxidative damage-induced apoptosis via upregulation of NF-kappaB activity REFERENCE 6 (bases 1 to 948) AUTHORS Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z., Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S., McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J., Dunham,I., Hill,D.E. and Vidal,M. TITLE hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes JOURNAL Genomics 89 (3), 307-315 (2007) PUBMED 17207965 REFERENCE 7 (bases 1 to 948) AUTHORS Roni,V., Carpio,R. and Wissinger,B. TITLE Mapping of transcription start sites of human retina expressed genes JOURNAL BMC Genomics 8, 42 (2007) PUBMED 17286855 REMARK Publication Status: Online-Only REFERENCE 8 (bases 1 to 948) AUTHORS Hanein,S., Perrault,I., Gerber,S., Dollfus,H., Dufier,J.L., Feingold,J., Munnich,A., Bhattacharya,S., Kaplan,J., Sahel,J.A., Rozet,J.M. and Leveillard,T. TITLE Disease-associated variants of the rod-derived cone viability factor (RdCVF) in Leber congenital amaurosis. Rod-derived cone viability variants in LCA JOURNAL Adv. Exp. Med. Biol. 572, 9-14 (2006) PUBMED 17249548 REMARK GeneRIF: RdCVF variants have roles in leber congenital amaurosis REFERENCE 9 (bases 1 to 948) AUTHORS Leveillard,T., Mohand-Said,S., Lorentz,O., Hicks,D., Fintz,A.C., Clerin,E., Simonutti,M., Forster,V., Cavusoglu,N., Chalmel,F., Dolle,P., Poch,O., Lambrou,G. and Sahel,J.A. TITLE Identification and characterization of rod-derived cone viability factor JOURNAL Nat. Genet. 36 (7), 755-759 (2004) PUBMED 15220920 REMARK GeneRIF: is a truncated thioredoxin-like protein specifically expressed by photoreceptors. The identification of this protein offers new treatment possibilities for retinitis pigmentosa COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC014127.1. ##Evidence-Data-START## Transcript exon combination :: BC014127.1, BG395178.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025084 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..948 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="19" /map="19p13.11" gene 1..948 /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /note="nucleoredoxin-like 1" /db_xref="GeneID:115861" /db_xref="HGNC:25179" /db_xref="HPRD:12300" /db_xref="MIM:608791" exon 1..373 /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /inference="alignment:Splign:1.39.8" variation complement(13) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="c" /replace="t" /db_xref="dbSNP:200603341" variation complement(17) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="g" /db_xref="dbSNP:371631664" variation complement(36) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="g" /db_xref="dbSNP:369023942" CDS 48..686 /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /note="rod-derived cone viability factor; thioredoxin-like 6; thioredoxin-like protein 6" /codon_start=1 /product="nucleoredoxin-like protein 1" /protein_id="NP_612463.1" /db_xref="GI:19923987" /db_xref="CCDS:CCDS12360.1" /db_xref="GeneID:115861" /db_xref="HGNC:25179" /db_xref="HPRD:12300" /db_xref="MIM:608791" /translation="
MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVRLTDEFYVLRAAQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADEIQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEKAARGGRDPGGGGGEEGGAGGLF
" misc_feature 69..506 /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /note="Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors. RdCVF was isolated and identified as a factor that supports cone survival in retinal...; Region: TryX_like_RdCVF; cd03008" /db_xref="CDD:48557" misc_feature order(177..179,186..188) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /note="putative catalytic residues [active]" /db_xref="CDD:48557" variation complement(48) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="g" /db_xref="dbSNP:142316793" variation complement(69) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="c" /replace="t" /db_xref="dbSNP:369921727" variation complement(71) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="c" /db_xref="dbSNP:140823542" variation complement(81) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="c" /replace="t" /db_xref="dbSNP:201151826" variation complement(82) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="g" /db_xref="dbSNP:376824868" variation complement(83) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="c" /db_xref="dbSNP:147394576" variation complement(92) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="c" /replace="t" /db_xref="dbSNP:142835364" variation complement(93) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="g" /db_xref="dbSNP:140610859" variation complement(112) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="c" /replace="t" /db_xref="dbSNP:375513833" variation complement(113) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="g" /db_xref="dbSNP:199712483" variation complement(114) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="g" /db_xref="dbSNP:144177332" variation complement(130) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="g" /db_xref="dbSNP:372809923" variation complement(134) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="g" /db_xref="dbSNP:368463370" variation complement(140) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="c" /replace="g" /db_xref="dbSNP:76407302" variation complement(151) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="g" /replace="t" /db_xref="dbSNP:80113786" variation complement(165) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="g" /replace="t" /db_xref="dbSNP:75189705" variation complement(198) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="g" /db_xref="dbSNP:374915427" variation complement(221) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="c" /replace="t" /db_xref="dbSNP:137874549" variation complement(225) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="c" /replace="t" /db_xref="dbSNP:182137093" variation complement(226) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="g" /db_xref="dbSNP:371790764" variation complement(233) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="g" /db_xref="dbSNP:367630859" variation complement(237) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="g" /db_xref="dbSNP:150719211" variation complement(243) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="c" /replace="t" /db_xref="dbSNP:374980877" variation complement(244) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="g" /db_xref="dbSNP:370480285" variation complement(252) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="c" /replace="t" /db_xref="dbSNP:372287276" variation complement(284) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="c" /db_xref="dbSNP:185508084" variation complement(291) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="c" /replace="t" /db_xref="dbSNP:368607758" variation complement(295) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="c" /replace="t" /db_xref="dbSNP:377352923" variation complement(296) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="g" /replace="t" /db_xref="dbSNP:374141772" variation complement(303) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="c" /replace="t" /db_xref="dbSNP:371083550" variation complement(315) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="c" /replace="t" /db_xref="dbSNP:78643580" variation complement(320) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="c" /replace="g" /db_xref="dbSNP:138621059" variation complement(322) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="g" /db_xref="dbSNP:201992877" variation complement(329) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="g" /replace="t" /db_xref="dbSNP:145106863" variation complement(330) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="c" /db_xref="dbSNP:373380579" exon 374..908 /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /inference="alignment:Splign:1.39.8" variation complement(377) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="c" /replace="t" /db_xref="dbSNP:371085748" variation complement(422) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="g" /replace="t" /db_xref="dbSNP:192929983" variation complement(425) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="c" /replace="g" /db_xref="dbSNP:375599803" variation complement(453) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="g" /db_xref="dbSNP:372954697" variation complement(455) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="c" /replace="t" /db_xref="dbSNP:112314563" variation complement(508) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="t" /db_xref="dbSNP:56248314" variation complement(519) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="g" /db_xref="dbSNP:373187772" variation complement(521) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="c" /replace="g" /db_xref="dbSNP:369694146" variation complement(532) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="g" /db_xref="dbSNP:10408265" variation complement(537) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="c" /db_xref="dbSNP:201159027" variation complement(568) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="c" /replace="t" /db_xref="dbSNP:201624169" variation complement(580) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="c" /replace="t" /db_xref="dbSNP:56084515" variation complement(733) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="a" /replace="c" /db_xref="dbSNP:56384297" variation complement(785) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="c" /replace="t" /db_xref="dbSNP:187776873" variation complement(869) /gene="NXNL1" /gene_synonym="RDCVF; TXNL6" /replace="c" /replace="t" /db_xref="dbSNP:183371494" ORIGIN
ccggggaccacacgccgcgctgtccccagcacccaacccaggttaccatggcctccctgttctctggccgcatcctgatccgcaacaatagcgaccaggacgagctggatacggaggctgaggtcagtcgcaggctggagaaccggctggtgctgctgttctttggtgctggggcttgtccacagtgccaggccttcgtgcccatcctcaaggacttcttcgtgcggctcacagatgagttctatgtactgcgggcggctcagctggccctggtgtacgtgtcccaggactccacggaggagcagcaggacctgttcctcaaggacatgccaaagaaatggcttttcctgccctttgaggatgatctgaggagggacctcgggcgccagttctcagtggagcgcctgccggcggtcgtggtgctcaagccggacggggacgtgctcactcgcgacggcgccgacgagatccagcgcctgggcaccgcctgcttcgccaactggcaggaggcggccgaggtgctggaccgcaacttccagctgccagaggacctggaggaccaggagccacggagcctcaccgagtgcctgcgccgccacaagtaccgcgtggaaaaggcggcgcgaggcgggcgcgaccccgggggagggggtggggaggagggcggggccggggggctgttctgacccgctagggtggaggagaggagtggggtttgttgatgaacctccacccccaccccacccccgcacgcctgtaatcccagcacttggggaggccaaggcgggaggatcgcttgagcccagaggttcgagatcaacctgggcaagagagtgagaccctgactctacgaaaattaaaagttagcccggtgtggtggcgcgcacctgtggcttagctaccctgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:115861 -> Cellular component: GO:0005640 [nuclear outer membrane] evidence: IEA GeneID:115861 -> Cellular component: GO:0005739 [mitochondrion] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.