GGRNA Home | Help | Advanced search

2019-03-25 14:29:14, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_133439               1327 bp    mRNA    linear   PRI 14-JUL-2013
DEFINITION  Homo sapiens transcriptional adaptor 2A (TADA2A), transcript
            variant 2, mRNA.
ACCESSION   NM_133439
VERSION     NM_133439.2  GI:68509267
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1327)
  AUTHORS   Pharoah PD, Tsai YY, Ramus SJ, Phelan CM, Goode EL, Lawrenson K,
            Buckley M, Fridley BL, Tyrer JP, Shen H, Weber R, Karevan R, Larson
            MC, Song H, Tessier DC, Bacot F, Vincent D, Cunningham JM, Dennis
            J, Dicks E, Aben KK, Anton-Culver H, Antonenkova N, Armasu SM,
            Baglietto L, Bandera EV, Beckmann MW, Birrer MJ, Bloom G, Bogdanova
            N, Brenton JD, Brinton LA, Brooks-Wilson A, Brown R, Butzow R,
            Campbell I, Carney ME, Carvalho RS, Chang-Claude J, Chen YA, Chen
            Z, Chow WH, Cicek MS, Coetzee G, Cook LS, Cramer DW, Cybulski C,
            Dansonka-Mieszkowska A, Despierre E, Doherty JA, Dork T, du Bois A,
            Durst M, Eccles D, Edwards R, Ekici AB, Fasching PA, Fenstermacher
            D, Flanagan J, Gao YT, Garcia-Closas M, Gentry-Maharaj A, Giles G,
            Gjyshi A, Gore M, Gronwald J, Guo Q, Halle MK, Harter P, Hein A,
            Heitz F, Hillemanns P, Hoatlin M, Hogdall E, Hogdall CK, Hosono S,
            Jakubowska A, Jensen A, Kalli KR, Karlan BY, Kelemen LE, Kiemeney
            LA, Kjaer SK, Konecny GE, Krakstad C, Kupryjanczyk J, Lambrechts D,
            Lambrechts S, Le ND, Lee N, Lee J, Leminen A, Lim BK, Lissowska J,
            Lubinski J, Lundvall L, Lurie G, Massuger LF, Matsuo K, McGuire V,
            McLaughlin JR, Menon U, Modugno F, Moysich KB, Nakanishi T, Narod
            SA, Ness RB, Nevanlinna H, Nickels S, Noushmehr H, Odunsi K, Olson
            S, Orlow I, Paul J, Pejovic T, Pelttari LM, Permuth-Wey J, Pike MC,
            Poole EM, Qu X, Risch HA, Rodriguez-Rodriguez L, Rossing MA,
            Rudolph A, Runnebaum I, Rzepecka IK, Salvesen HB, Schwaab I, Severi
            G, Shen H, Shridhar V, Shu XO, Sieh W, Southey MC, Spellman P,
            Tajima K, Teo SH, Terry KL, Thompson PJ, Timorek A, Tworoger SS,
            van Altena AM, van den Berg D, Vergote I, Vierkant RA, Vitonis AF,
            Wang-Gohrke S, Wentzensen N, Whittemore AS, Wik E, Winterhoff B,
            Woo YL, Wu AH, Yang HP, Zheng W, Ziogas A, Zulkifli F, Goodman MT,
            Hall P, Easton DF, Pearce CL, Berchuck A, Chenevix-Trench G,
            Iversen E, Monteiro AN, Gayther SA, Schildkraut JM and Sellers TA.
  CONSRTM   Australian Cancer Study; Australian Ovarian Cancer Study Group
  TITLE     GWAS meta-analysis and replication identifies three new
            susceptibility loci for ovarian cancer
  JOURNAL   Nat. Genet. 45 (4), 362-370 (2013)
   PUBMED   23535730
REFERENCE   2  (bases 1 to 1327)
  AUTHORS   Huang,J., Zhang,L., Liu,W., Liao,Q., Shi,T., Xiao,L., Hu,F. and
            Qiu,X.
  TITLE     CCDC134 interacts with hADA2a and functions as a regulator of
            hADA2a in acetyltransferase activity, DNA damage-induced apoptosis
            and cell cycle arrest
  JOURNAL   Histochem. Cell Biol. 138 (1), 41-55 (2012)
   PUBMED   22644376
  REMARK    GeneRIF: CCDC134 increased the PCAF-dependent K320 acetylation of
            p53 and p53 protein stability in the presence of hADA2a
            overexpression.
REFERENCE   3  (bases 1 to 1327)
  AUTHORS   Ruano,G., Thompson,P.D., Kane,J.P., Pullinger,C.R., Windemuth,A.,
            Seip,R.L., Kocherla,M., Holford,T.R. and Wu,A.H.
  TITLE     Physiogenomic analysis of statin-treated patients: domain-specific
            counter effects within the ACACB gene on low-density lipoprotein
            cholesterol?
  JOURNAL   Pharmacogenomics 11 (7), 959-971 (2010)
   PUBMED   20602615
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   4  (bases 1 to 1327)
  AUTHORS   Yang,M., Waterman,M.L. and Brachmann,R.K.
  TITLE     hADA2a and hADA3 are required for acetylation, transcriptional
            activity and proliferative effects of beta-catenin
  JOURNAL   Cancer Biol. Ther. 7 (1), 120-128 (2008)
   PUBMED   18059173
  REMARK    GeneRIF: hADA2a and hADA3 as crucial cofactors of beta-catenin that
            are likely involved in the assembly of transactivation-competent
            beta-catenin complexes at Wnt target genes.
REFERENCE   5  (bases 1 to 1327)
  AUTHORS   Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z.,
            Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S.,
            McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J.,
            Dunham,I., Hill,D.E. and Vidal,M.
  TITLE     hORFeome v3.1: a resource of human open reading frames representing
            over 10,000 human genes
  JOURNAL   Genomics 89 (3), 307-315 (2007)
   PUBMED   17207965
REFERENCE   6  (bases 1 to 1327)
  AUTHORS   Ogryzko,V.V., Kotani,T., Zhang,X., Schiltz,R.L., Howard,T.,
            Yang,X.J., Howard,B.H., Qin,J. and Nakatani,Y.
  TITLE     Histone-like TAFs within the PCAF histone acetylase complex
  JOURNAL   Cell 94 (1), 35-44 (1998)
   PUBMED   9674425
REFERENCE   7  (bases 1 to 1327)
  AUTHORS   Henriksson,A., Almlof,T., Ford,J., McEwan,I.J., Gustafsson,J.A. and
            Wright,A.P.
  TITLE     Role of the Ada adaptor complex in gene activation by the
            glucocorticoid receptor
  JOURNAL   Mol. Cell. Biol. 17 (6), 3065-3073 (1997)
   PUBMED   9154805
REFERENCE   8  (bases 1 to 1327)
  AUTHORS   Carter,K.C., Wang,L., Shell,B.K., Zamir,I., Berger,S.L. and
            Moore,P.A.
  TITLE     The human transcriptional adaptor genes TADA2L and GCN5L2
            colocalize to chromosome 17q12-q21 and display a similar tissue
            expression pattern
  JOURNAL   Genomics 40 (3), 497-500 (1997)
   PUBMED   9073520
REFERENCE   9  (bases 1 to 1327)
  AUTHORS   Wang,L., Mizzen,C., Ying,C., Candau,R., Barlev,N., Brownell,J.,
            Allis,C.D. and Berger,S.L.
  TITLE     Histone acetyltransferase activity is conserved between yeast and
            human GCN5 and is required for complementation of growth and
            transcriptional activation
  JOURNAL   Mol. Cell. Biol. 17 (1), 519-527 (1997)
   PUBMED   8972232
REFERENCE   10 (bases 1 to 1327)
  AUTHORS   Candau,R., Moore,P.A., Wang,L., Barlev,N., Ying,C.Y., Rosen,C.A.
            and Berger,S.L.
  TITLE     Identification of human proteins functionally conserved with the
            yeast putative adaptors ADA2 and GCN5
  JOURNAL   Mol. Cell. Biol. 16 (2), 593-602 (1996)
   PUBMED   8552087
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AK022767.1, AL526501.3 and
            BC001172.1.
            On Jul 1, 2005 this sequence version replaced gi:19743890.
            
            Summary: Many DNA-binding transcriptional activator proteins
            enhance the initiation rate of RNA polymerase II-mediated gene
            transcription by interacting functionally with the general
            transcription machinery bound at the basal promoter. Adaptor
            proteins are usually required for this activation, possibly to
            acetylate and destabilize nucleosomes, thereby relieving chromatin
            constraints at the promoter. The protein encoded by this gene is a
            transcriptional activator adaptor and has been found to be part of
            the PCAF histone acetylase complex. Several alternatively spliced
            transcript variants encoding different isoforms of this gene have
            been described, but the full-length nature of some of these
            variants has not been determined. [provided by RefSeq, Oct 2009].
            
            Transcript Variant: This variant (2) represents an alternate
            transcript termination and polyadenylation site. This results in a
            shorter isoform (b) which has a distinct C-terminus.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            CDS exon combination :: BC001172.1 [ECO:0000331]
            RNAseq introns       :: single sample supports all introns
                                    ERS025084, ERS025085 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-384               AK022767.1         4-387
            385-1038            AL526501.3         155-808
            1039-1327           BC001172.1         778-1066
FEATURES             Location/Qualifiers
     source          1..1327
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="17"
                     /map="17q12-q21"
     gene            1..1327
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /note="transcriptional adaptor 2A"
                     /db_xref="GeneID:6871"
                     /db_xref="HGNC:11531"
                     /db_xref="MIM:602276"
     exon            1..272
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /inference="alignment:Splign:1.39.8"
     variation       7
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:76455262"
     variation       42
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:189322822"
     variation       160
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:829164"
     variation       191
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:118185891"
     exon            273..394
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /inference="alignment:Splign:1.39.8"
     variation       326
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:186419906"
     variation       354
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:17138766"
     variation       355
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140453764"
     variation       362
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201818113"
     misc_feature    364..366
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /note="upstream in-frame stop codon"
     CDS             370..1287
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /note="isoform b is encoded by transcript variant 2;
                     transcriptional adaptor 2 alpha; transcriptional adapter
                     2-alpha; ADA2-like protein"
                     /codon_start=1
                     /product="transcriptional adapter 2-alpha isoform b"
                     /protein_id="NP_597683.2"
                     /db_xref="GI:68509268"
                     /db_xref="CCDS:CCDS45656.1"
                     /db_xref="GeneID:6871"
                     /db_xref="HGNC:11531"
                     /db_xref="MIM:602276"
                     /translation="
MDRLGPFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEIMTSDFPVLDPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKHFINNPLFASTLLNLKQAEEAKTADTAIPFHSTDDPPRPTFDSLLSRDMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQLMERRYPKEVQDLYETMRRFARIVGPVEHDKFIESHACRWFLSLEQYLCVYIYINRRDNGVFYVKFYK
"
     misc_feature    412..561
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /note="Zinc finger, ZZ type. Zinc finger present in ADA2,
                     a putative transcriptional adaptor, and related proteins.
                     The ZZ motif coordinates two zinc ions and most likely
                     participates in ligand binding or molecular scaffolding;
                     Region: ZZ_ADA2; cd02335"
                     /db_xref="CDD:30239"
     misc_feature    order(418..420,427..429,460..462,469..471,493..495,
                     502..504,532..534,544..546)
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /note="Zinc-binding sites [ion binding]; other site"
                     /db_xref="CDD:30239"
     misc_feature    order(418..420,427..429,493..495,502..504)
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /note="zinc cluster 1 [ion binding]; other site"
                     /db_xref="CDD:30239"
     misc_feature    order(421..423,451..453,457..459,481..483,487..489)
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /note="putative charged binding surface; other site"
                     /db_xref="CDD:30239"
     misc_feature    451..>1185
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /note="Histone acetyltransferase complex SAGA/ADA, subunit
                     ADA2 [Chromatin structure and dynamics]; Region: COG5114"
                     /db_xref="CDD:34717"
     misc_feature    order(454..456,505..507,550..552,559..561)
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /note="putative hydrophobic binding surface; other site"
                     /db_xref="CDD:30239"
     misc_feature    order(460..462,469..471,532..534,544..546)
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /note="zinc cluster 2 [ion binding]; other site"
                     /db_xref="CDD:30239"
     misc_feature    589..723
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /note="'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains.
                     Tandem copies of the domain bind telomeric DNA tandem
                     repeatsas part of the capping complex. Binding is sequence
                     dependent for repeats which contain the G/C rich motif
                     [C2-3 A (CA)1-6]. The domain is...; Region: SANT; cd00167"
                     /db_xref="CDD:29107"
     misc_feature    order(592..594,682..687,691..696,700..708,712..720)
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:29107"
     variation       377
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374991405"
     variation       378
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369370248"
     variation       385
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:7211875"
     variation       387
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:112855394"
     exon            395..501
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /inference="alignment:Splign:1.39.8"
     variation       402
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138178971"
     variation       420
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370683055"
     variation       421
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:143836210"
     variation       422
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200118946"
     exon            502..561
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /inference="alignment:Splign:1.39.8"
     variation       545
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374099682"
     variation       546
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368270238"
     variation       552
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372228881"
     exon            562..653
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /inference="alignment:Splign:1.39.8"
     variation       568
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141037954"
     variation       587
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147950347"
     variation       600
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368442122"
     variation       611
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:369092308"
     exon            654..811
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /inference="alignment:Splign:1.39.8"
     variation       668
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148703392"
     variation       681
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373018253"
     variation       687
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:186965965"
     variation       692
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:147234139"
     variation       712
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1054865"
     variation       718
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17849432"
     variation       779
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:187764026"
     variation       793
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:78395792"
     variation       802
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:34408045"
     exon            812..900
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /inference="alignment:Splign:1.39.8"
     variation       816
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199556759"
     variation       828
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143700497"
     variation       884
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374860776"
     variation       900
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:377490313"
     exon            901..973
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /inference="alignment:Splign:1.39.8"
     variation       913
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375889975"
     variation       915
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144064854"
     variation       917
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367698801"
     variation       960
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148661084"
     variation       971
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142136696"
     exon            974..1037
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /inference="alignment:Splign:1.39.8"
     variation       1031
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367602386"
     exon            1038..1081
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /inference="alignment:Splign:1.39.8"
     variation       1042
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150744923"
     variation       1081
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:371661972"
     exon            1082..1304
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /inference="alignment:Splign:1.39.8"
     variation       1085
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184173195"
     variation       1094
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376421675"
     variation       1112
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201607716"
     variation       1119
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139151064"
     variation       1172
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143994775"
     variation       1189
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188630265"
     variation       1234
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:191536856"
     variation       1262
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:141558348"
     polyA_signal    1287..1292
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
     polyA_site      1304
                     /gene="TADA2A"
                     /gene_synonym="ADA2; ADA2A; hADA2; KL04P; TADA2L"
ORIGIN      
tttcccgctcagccctggagcgcgtagctctaccaagaatggccactgtgccagatgcccctgaccagcgttgcccatttgaatttcctagcaggccccccaaagtaggtatttcagtaccctgttagagctgaggcgcaggtaaaatgactggcccaggccggtcccaccccgtaaggatttgaacgttggctccacaactcgggagcctgcgcctttcctcctcccaacgtggactcctgcccggcgaagtgcctcacttccttctcccgggagtcatcaagctttggtgtatgtgttggccggttctgaagtcttgaagaagctctgctgaggaagaccaaagcagcactcgttgccaattagggaatggaccgtttgggtccctttagcaatgatccctctgataagccaccttgccgaggctgctcctcctacctcatggagccttatatcaagtgtgctgaatgtgggccacctccttttttcctctgcttgcagtgtttcactcgaggctttgagtacaagaaacatcaaagcgatcatacttatgaaataatgacttcagattttcctgtccttgatcccagctggactgctcaagaagaaatggcccttttagaagctgtgatggactgtggctttggaaattggcaggatgtagccaatcaaatgtgcaccaagaccaaggaggagtgtgagaagcactatatgaagcatttcatcaataaccctctgtttgcatctaccctgctgaacctgaaacaagcagaggaagcaaaaactgctgacacagccattccatttcactctacagatgaccctccccgacctacctttgactccttgctttctcgggacatggccgggtacatgccagctcgagcagatttcattgaggaatttgacaattatgcagaatgggacttgagagacattgattttgttgaagatgactcggacattttacatgctctgaagatggctgtggtagatatctatcattccaggttaaaggagagacaaagacgaaaaaaaattataagagaccatggattaatcaaccttagaaagtttcaattaatggaacggcggtatcccaaggaggtccaggacctgtatgaaacaatgaggcgatttgcaagaattgtggggccagtggaacatgacaaattcattgaaagccatgcatgtaggtggtttttgagccttgagcagtatttgtgtgtgtatatttatataaataggagagataatggtgtgttttatgtgaagttctataaataaataaatggatatttctcaaaaaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:6871 -> Molecular function: GO:0003677 [DNA binding] evidence: IEA
            GeneID:6871 -> Molecular function: GO:0003682 [chromatin binding] evidence: IEA
            GeneID:6871 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: TAS
            GeneID:6871 -> Molecular function: GO:0003712 [transcription cofactor activity] evidence: TAS
            GeneID:6871 -> Molecular function: GO:0004402 [histone acetyltransferase activity] evidence: IDA
            GeneID:6871 -> Molecular function: GO:0008270 [zinc ion binding] evidence: IEA
            GeneID:6871 -> Biological process: GO:0001932 [regulation of protein phosphorylation] evidence: IEA
            GeneID:6871 -> Biological process: GO:0006366 [transcription from RNA polymerase II promoter] evidence: TAS
            GeneID:6871 -> Biological process: GO:0007067 [mitosis] evidence: IEA
            GeneID:6871 -> Biological process: GO:0031063 [regulation of histone deacetylation] evidence: IEA
            GeneID:6871 -> Biological process: GO:0031647 [regulation of protein stability] evidence: IEA
            GeneID:6871 -> Biological process: GO:0043966 [histone H3 acetylation] evidence: IDA
            GeneID:6871 -> Biological process: GO:0090043 [regulation of tubulin deacetylation] evidence: IEA
            GeneID:6871 -> Cellular component: GO:0000125 [PCAF complex] evidence: IDA
            GeneID:6871 -> Cellular component: GO:0005634 [nucleus] evidence: TAS
            GeneID:6871 -> Cellular component: GO:0005671 [Ada2/Gcn5/Ada3 transcription activator complex] evidence: IEA
            GeneID:6871 -> Cellular component: GO:0005694 [chromosome] evidence: IEA
            GeneID:6871 -> Cellular component: GO:0072686 [mitotic spindle] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.