GGRNA Home | Help | Advanced search

2019-03-24 19:38:41, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_133367               4758 bp    mRNA    linear   PRI 07-JUL-2013
DEFINITION  Homo sapiens progestin and adipoQ receptor family member VIII
            (PAQR8), mRNA.
ACCESSION   NM_133367
VERSION     NM_133367.4  GI:164607179
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4758)
  AUTHORS   Charles,N.J., Thomas,P. and Lange,C.A.
  TITLE     Expression of membrane progesterone receptors (mPR/PAQR) in ovarian
            cancer cells: implications for progesterone-induced signaling
            events
  JOURNAL   Horm Cancer 1 (4), 167-176 (2010)
   PUBMED   21761364
  REMARK    GeneRIF: Data show abundant mPRalpha (PAQR7), mPRbeta (PAQR8), and
            mPRgamma (PAQR5), but not classical nuclear PR (A or B isoforms)
            mRNA expression and mPRalpha protein expression in a panel of
            commonly used ovarian cancer cell lines.
REFERENCE   2  (bases 1 to 4758)
  AUTHORS   Smith,J.L., Kupchak,B.R., Garitaonandia,I., Hoang,L.K., Maina,A.S.,
            Regalla,L.M. and Lyons,T.J.
  TITLE     Heterologous expression of human mPRalpha, mPRbeta and mPRgamma in
            yeast confirms their ability to function as membrane progesterone
            receptors
  JOURNAL   Steroids 73 (11), 1160-1173 (2008)
   PUBMED   18603275
  REMARK    GeneRIF: Heterologous expression of MPRB in yeast confirms its
            ability to function as a membrane progesterone receptor.
REFERENCE   3  (bases 1 to 4758)
  AUTHORS   Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z.,
            Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S.,
            McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J.,
            Dunham,I., Hill,D.E. and Vidal,M.
  TITLE     hORFeome v3.1: a resource of human open reading frames representing
            over 10,000 human genes
  JOURNAL   Genomics 89 (3), 307-315 (2007)
   PUBMED   17207965
REFERENCE   4  (bases 1 to 4758)
  AUTHORS   Tang,Y.T., Hu,T., Arterburn,M., Boyle,B., Bright,J.M., Emtage,P.C.
            and Funk,W.D.
  TITLE     PAQR proteins: a novel membrane receptor family defined by an
            ancient 7-transmembrane pass motif
  JOURNAL   J. Mol. Evol. 61 (3), 372-380 (2005)
   PUBMED   16044242
REFERENCE   5  (bases 1 to 4758)
  AUTHORS   Mungall,A.J., Palmer,S.A., Sims,S.K., Edwards,C.A., Ashurst,J.L.,
            Wilming,L., Jones,M.C., Horton,R., Hunt,S.E., Scott,C.E.,
            Gilbert,J.G., Clamp,M.E., Bethel,G., Milne,S., Ainscough,R.,
            Almeida,J.P., Ambrose,K.D., Andrews,T.D., Ashwell,R.I.,
            Babbage,A.K., Bagguley,C.L., Bailey,J., Banerjee,R., Barker,D.J.,
            Barlow,K.F., Bates,K., Beare,D.M., Beasley,H., Beasley,O.,
            Bird,C.P., Blakey,S., Bray-Allen,S., Brook,J., Brown,A.J.,
            Brown,J.Y., Burford,D.C., Burrill,W., Burton,J., Carder,C.,
            Carter,N.P., Chapman,J.C., Clark,S.Y., Clark,G., Clee,C.M.,
            Clegg,S., Cobley,V., Collier,R.E., Collins,J.E., Colman,L.K.,
            Corby,N.R., Coville,G.J., Culley,K.M., Dhami,P., Davies,J.,
            Dunn,M., Earthrowl,M.E., Ellington,A.E., Evans,K.A., Faulkner,L.,
            Francis,M.D., Frankish,A., Frankland,J., French,L., Garner,P.,
            Garnett,J., Ghori,M.J., Gilby,L.M., Gillson,C.J., Glithero,R.J.,
            Grafham,D.V., Grant,M., Gribble,S., Griffiths,C., Griffiths,M.,
            Hall,R., Halls,K.S., Hammond,S., Harley,J.L., Hart,E.A.,
            Heath,P.D., Heathcott,R., Holmes,S.J., Howden,P.J., Howe,K.L.,
            Howell,G.R., Huckle,E., Humphray,S.J., Humphries,M.D., Hunt,A.R.,
            Johnson,C.M., Joy,A.A., Kay,M., Keenan,S.J., Kimberley,A.M.,
            King,A., Laird,G.K., Langford,C., Lawlor,S., Leongamornlert,D.A.,
            Leversha,M., Lloyd,C.R., Lloyd,D.M., Loveland,J.E., Lovell,J.,
            Martin,S., Mashreghi-Mohammadi,M., Maslen,G.L., Matthews,L.,
            McCann,O.T., McLaren,S.J., McLay,K., McMurray,A., Moore,M.J.,
            Mullikin,J.C., Niblett,D., Nickerson,T., Novik,K.L., Oliver,K.,
            Overton-Larty,E.K., Parker,A., Patel,R., Pearce,A.V., Peck,A.I.,
            Phillimore,B., Phillips,S., Plumb,R.W., Porter,K.M., Ramsey,Y.,
            Ranby,S.A., Rice,C.M., Ross,M.T., Searle,S.M., Sehra,H.K.,
            Sheridan,E., Skuce,C.D., Smith,S., Smith,M., Spraggon,L.,
            Squares,S.L., Steward,C.A., Sycamore,N., Tamlyn-Hall,G., Tester,J.,
            Theaker,A.J., Thomas,D.W., Thorpe,A., Tracey,A., Tromans,A.,
            Tubby,B., Wall,M., Wallis,J.M., West,A.P., White,S.S.,
            Whitehead,S.L., Whittaker,H., Wild,A., Willey,D.J., Wilmer,T.E.,
            Wood,J.M., Wray,P.W., Wyatt,J.C., Young,L., Younger,R.M.,
            Bentley,D.R., Coulson,A., Durbin,R., Hubbard,T., Sulston,J.E.,
            Dunham,I., Rogers,J. and Beck,S.
  TITLE     The DNA sequence and analysis of human chromosome 6
  JOURNAL   Nature 425 (6960), 805-811 (2003)
   PUBMED   14574404
REFERENCE   6  (bases 1 to 4758)
  AUTHORS   Hammes,S.R.
  TITLE     The further redefining of steroid-mediated signaling
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 100 (5), 2168-2170 (2003)
   PUBMED   12606724
REFERENCE   7  (bases 1 to 4758)
  AUTHORS   Zhu,Y., Bond,J. and Thomas,P.
  TITLE     Identification, classification, and partial characterization of
            genes in humans and other vertebrates homologous to a fish membrane
            progestin receptor
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 100 (5), 2237-2242 (2003)
   PUBMED   12601167
REFERENCE   8  (bases 1 to 4758)
  AUTHORS   Zhu,Y., Rice,C.D., Pang,Y., Pace,M. and Thomas,P.
  TITLE     Cloning, expression, and characterization of a membrane progestin
            receptor and evidence it is an intermediary in meiotic maturation
            of fish oocytes
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 100 (5), 2231-2236 (2003)
   PUBMED   12574519
REFERENCE   9  (bases 1 to 4758)
  AUTHORS   Wistow,G., Bernstein,S.L., Ray,S., Wyatt,M.K., Behal,A.,
            Touchman,J.W., Bouffard,G., Smith,D. and Peterson,K.
  TITLE     Expressed sequence tag analysis of adult human iris for the NEIBank
            Project: steroid-response factors and similarities with retinal
            pigment epithelium
  JOURNAL   Mol. Vis. 8, 185-195 (2002)
   PUBMED   12107412
  REMARK    Publication Status: Online-Only
REFERENCE   10 (bases 1 to 4758)
  AUTHORS   Suzuki,T., Ganesh,S., Agarwala,K.L., Morita,R., Sugimoto,Y.,
            Inazawa,J., Delgado-Escueta,A.V. and Yamakawa,K.
  TITLE     A novel gene in the chromosomal region for juvenile myoclonic
            epilepsy on 6p12 encodes a brain-specific lysosomal membrane
            protein
  JOURNAL   Biochem. Biophys. Res. Commun. 288 (3), 626-636 (2001)
   PUBMED   11676489
  REMARK    GeneRIF: LMPB1 is indeed an integral membrane protein that targets
            to lysosomal structures.
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CN283490.1, BC030664.2, AF347029.1, AK128085.1, CN395844.1,
            AI655504.1, AI656485.1 and CD672455.1.
            On Jan 11, 2008 this sequence version replaced gi:142360293.
            
            Sequence Note: An in-frame AUG is located 5 codons upstream of the
            annotated translation start site but is not being annotated as a
            start site since it is not conserved and is in a weak Kozak
            sequence context.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF347029.1, BC030664.2 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025082 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            CDS uses downstream in-frame AUG :: upstream AUG and CDS extension
                                                is not conserved
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-91                CN283490.1         3-93
            92-226              BC030664.2         67-201
            227-1709            AF347029.1         217-1699
            1710-3109           AK128085.1         1930-3329
            3110-3366           AF347029.1         3100-3356
            3367-3891           CN395844.1         120-644
            3892-4195           AF347029.1         3882-4185
            4196-4630           AI655504.1         15-449              c
            4631-4665           AI656485.1         67-101              c
            4666-4758           CD672455.1         2-94                c
FEATURES             Location/Qualifiers
     source          1..4758
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="6"
                     /map="6p12.1"
     gene            1..4758
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /note="progestin and adipoQ receptor family member VIII"
                     /db_xref="GeneID:85315"
                     /db_xref="HGNC:15708"
                     /db_xref="HPRD:07415"
                     /db_xref="MIM:607780"
     exon            1..122
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /inference="alignment:Splign:1.39.8"
     variation       17
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:191001671"
     variation       59
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:116616218"
     variation       91
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:75731219"
     exon            123..4738
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /inference="alignment:Splign:1.39.8"
     variation       130
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:76408349"
     misc_feature    139..141
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /note="upstream in-frame stop codon"
     variation       147
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369803709"
     variation       148
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372154133"
     variation       151
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:200500298"
     variation       152
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376715477"
     variation       163
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186101109"
     variation       171
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:3748066"
     CDS             175..1239
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /note="lysosomal membrane protein in brain-1; mPR beta;
                     lysosomal membrane protein in brain 1; progestin and
                     adipoQ receptor family member 8"
                     /codon_start=1
                     /product="membrane progestin receptor beta"
                     /protein_id="NP_588608.1"
                     /db_xref="GI:19115960"
                     /db_xref="CCDS:CCDS4941.1"
                     /db_xref="GeneID:85315"
                     /db_xref="HGNC:15708"
                     /db_xref="HPRD:07415"
                     /db_xref="MIM:607780"
                     /translation="
MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFAEAEALPWASTHSLPLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYDRFWLFFLPAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLAFILDISPVAHRVALCHLAGCQEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAILLDYQGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLTKKDS
"
     misc_feature    382..1065
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /note="Haemolysin-III related; Region: HlyIII; pfam03006"
                     /db_xref="CDD:202506"
     misc_feature    400..462
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8TEZ7.1);
                     transmembrane region"
     misc_feature    508..570
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8TEZ7.1);
                     transmembrane region"
     misc_feature    697..759
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8TEZ7.1);
                     transmembrane region"
     misc_feature    814..876
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8TEZ7.1);
                     transmembrane region"
     misc_feature    904..966
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8TEZ7.1);
                     transmembrane region"
     misc_feature    1024..1086
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8TEZ7.1);
                     transmembrane region"
     misc_feature    1132..1194
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8TEZ7.1);
                     transmembrane region"
     variation       177
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142356924"
     variation       204
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199612771"
     variation       227
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11547629"
     variation       237
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377157923"
     variation       247
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:201270388"
     variation       249
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146353145"
     variation       262
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200919654"
     variation       281
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373953889"
     variation       300
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374831754"
     variation       322
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:369229031"
     variation       339
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:202158705"
     variation       347
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138992716"
     variation       357
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149431852"
     variation       427
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:372673680"
     variation       432
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375919138"
     variation       435
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199504597"
     variation       493
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144826376"
     variation       501
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200119544"
     variation       519
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148145077"
     variation       528
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141938620"
     variation       540
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146222436"
     variation       609
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:139194968"
     variation       617
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370975550"
     variation       631
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:142393775"
     variation       654
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:74405742"
     variation       694
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201072442"
     variation       772
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17852802"
     variation       778
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375572897"
     variation       800
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201218948"
     variation       820
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367615474"
     variation       827
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:145941593"
     variation       840
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376990670"
     variation       858
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368517740"
     variation       880
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200866188"
     variation       883
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140488811"
     variation       912
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376682976"
     variation       948
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370008138"
     variation       965
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372503178"
     variation       966
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370377259"
     variation       989
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200187474"
     variation       995
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201451220"
     variation       1005
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:34615735"
     variation       1013
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145599025"
     variation       1047
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369094262"
     variation       1053
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:17591381"
     variation       1125
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376669883"
     variation       1129
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142603946"
     variation       1209
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:3799274"
     variation       1314
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:655113"
     variation       1362
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3799272"
     variation       1412
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112982203"
     variation       1470
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:75489244"
     variation       1642
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150433385"
     variation       1710
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3180067"
     variation       1740
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183323842"
     variation       1800
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138127368"
     variation       1848
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:3180068"
     variation       1896
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:80028877"
     variation       1924
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:370353848"
     variation       2088
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142766813"
     variation       2099
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:10484875"
     variation       2127
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188328738"
     variation       2219
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145140258"
     variation       2240
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:139011045"
     variation       2270
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:191126871"
     variation       2271
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182968639"
     variation       2370
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:142295765"
     STS             2460..2738
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /standard_name="WI-20795"
                     /db_xref="UniSTS:31178"
     variation       2520
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4489154"
     variation       2550
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373801807"
     variation       2571
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:186794124"
     variation       2589
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144775008"
     variation       2661..2662
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace=""
                     /replace="ca"
                     /db_xref="dbSNP:145558413"
     variation       2667
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:9395789"
     variation       2706..2707
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace=""
                     /replace="ttg"
                     /db_xref="dbSNP:148432475"
     variation       2707..2708
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace=""
                     /replace="gtt"
                     /db_xref="dbSNP:76546426"
     variation       2708..2709
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace=""
                     /replace="gtt"
                     /db_xref="dbSNP:150039094"
     variation       2710
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace=""
                     /replace="g"
                     /replace="gtt"
                     /replace="ttg"
                     /db_xref="dbSNP:66914305"
     variation       2710
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:3062685"
     variation       2712
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace=""
                     /replace="gtt"
                     /db_xref="dbSNP:375705338"
     variation       2787
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:682123"
     variation       2838
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:192670192"
     variation       2884
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183372800"
     variation       2905
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371606102"
     variation       3003
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:114394302"
     variation       3063
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141666092"
     variation       3088
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:41273736"
     variation       3134
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:187772580"
     variation       3155
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:10807445"
     variation       3171
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:115283517"
     variation       3178
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:193168633"
     variation       3319
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185099953"
     variation       3358..3359
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace=""
                     /replace="ag"
                     /db_xref="dbSNP:141632223"
     variation       3367
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4715300"
     variation       3414
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376983107"
     variation       3475
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:189953789"
     variation       3563
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192693244"
     variation       3624
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:368035029"
     variation       3673
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150542544"
     variation       3766
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184642894"
     variation       3792
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371960053"
     variation       3870
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6933844"
     variation       4056
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:78660713"
     variation       4085
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:188190518"
     variation       4113
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:11547628"
     variation       4120
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:57711550"
     variation       4166..4167
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:375040150"
     variation       4196
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:474848"
     variation       4255
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:180682853"
     variation       4368
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186355834"
     STS             4420..4505
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /standard_name="STS-Z41287"
                     /db_xref="UniSTS:32661"
     STS             4429..4616
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /standard_name="A001Z23"
                     /db_xref="UniSTS:23401"
     STS             4429..4616
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /standard_name="G19819"
                     /db_xref="UniSTS:23400"
     STS             4456..4599
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /standard_name="WIAF-2212"
                     /db_xref="UniSTS:11406"
     variation       4476
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1297"
     variation       4523
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375841956"
     variation       4589
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:116301436"
     variation       4600
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140250304"
     variation       4604
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:189197906"
     variation       4630..4631
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace=""
                     /replace="ttga"
                     /db_xref="dbSNP:142216142"
     variation       4631..4632
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace=""
                     /replace="ttga"
                     /db_xref="dbSNP:71656124"
     variation       4633..4634
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace=""
                     /replace="attg"
                     /db_xref="dbSNP:56863191"
     variation       4634
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2397089"
     variation       4640..4643
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace=""
                     /replace="aaaa"
                     /db_xref="dbSNP:66568416"
     variation       4650..4651
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace=""
                     /replace="a"
                     /replace="aaa"
                     /db_xref="dbSNP:5876275"
     variation       4661..4671
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace=""
                     /replace="aaaaaaaaaaa"
                     /db_xref="dbSNP:59624221"
     variation       4690
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115618962"
     variation       4737
                     /gene="PAQR8"
                     /gene_synonym="C6orf33; LMPB1; MPRB"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4498353"
ORIGIN      
cccgagccgagcccgccgcggtcacagccacccgcgggaagctcgtggccgggaccccgaggcgggagcgcgggctgggccgggctgggctacgcgcacgggctcggccgccgcccctgccggttgcataccctgtcctgagggcgcggcacggagtgcatgcgggccgctgccatgacgaccgccatcttggagcgcctgagcaccctgtcggtcagcgggcagcagctgcgccgcctgcccaagatcctggaggatgggcttcccaagatgccttgcactgtcccagaaacggatgtgccccagctcttccgggagccttacatccgcaccggctaccgccccacggggcacgagtggcgctactacttcttcagcctctttcagaaacacaacgaggtggtcaacgtctggacccatttactggcagccctggccgtcctcttgcgattctgggcctttgccgaggctgaggccttgccatgggcgtctacccactccctgcctctgctcctcttcatcctgtcgtcaatcacttacctcacctgcagccttctggcccacctgctgcagtccaagtcagagctctcccactacaccttctactttgtggactatgttggcgtgagcgtttaccaatatggcagtgctttggctcatttcttctacagctctgaccaggcctggtatgaccggttctggcttttcttcttgccagcagctgccttctgtggctggttatcttgtgctggctgttgctatgccaaatatcgttaccggaggccttatccagtcatgaggaagatctgtcaagtggtgccagcaggtctggcttttatcctagacatcagccctgtggcacaccgtgtggcgctctgtcacctggctggctgccaggagcaagcagcctggtaccacaccctccagatcctcttcttcctggttagcgcttatttcttctcctgccccgtgcctgagaagtacttcccgggttcctgtgacatcgtgggccatgggcatcagatcttccatgcatttctgtccatctgtacgctctcccagctggaggccatcctcctggactaccaggggcggcaggagatcttcctgcagcgccatggacccctatctgtccacatggcctgcctctccttcttcttcctggctgcctgcagtgctgccaccgcagcccttctgaggcacaaagtcaaggccagactgaccaagaaagattcctgaggctggcaagtggggcaacgtgtggaggaagcccctcataatttggagaaaacttgatacaatagaagctgacttttaaggcattggcttttaaattaatacatatatccaaggatatgttatagctgcagtgtttgaaagccaaaggatttaagagttttgttgttgttaataaaaggaatactccttttccttttggatcatagcttaacaaggcacaggaagggaagggatcttgactaagattcatgagacattgaattaaggagaatcatcttcatgcctgaaaatttagcaaaattccgactatggcctccaggggcaattcctaaaagctgaatggataataaaattggactggaaagtaagtaggtggctggtcctcaccctgttggaatggctatcctactatgctgttctttggtaatggaataaattgacccaaggaccgaatttcatttggatttcaaattgtccagagtggaaaagccttcaagatgacatgatgaattactcagttcatctgatttctggtccctcctttctcgacaactataatactaacccttttctcaggataactgtctacacctggcagttttctctgacgtgctgttcactcacatccctaccttgcatggtaatataaaggactaggaagcagtcatacttccaggaaatgcttggattcatgtggacattcaggaagcttattctcatataatactaatctaaacagtactagaaattacagtgccaagagccaccaggaggcccagccaataagcatagatactatatggtatcatgggacccatctattttttaccagtggactacaggattacttgagagttatcagggctgcctaacagaccaggagatctgggggttgcaccagggaatcgccatatttgaccagcatgttttaaaagctcttggtaggattagttggttctaaggatccctctagggacctcattatttcaagaggaacccaaagtccagcctcctacatagatgctgccccacgaaggacccacaaaactaacctagttcagggttctcaggcaggcagttctgcttcagcttagagcagaacccataaaatactcaagtactgggataggcaagcatgtgtgtttactgtggattggtccctgaaggctcctttgggtgagaacatgtgaaccaggcaccctggtttgtttggagcattgctgcccagaagcttctatgggataggtggtgcttgggattgatgtgttgtggccatgcagccctccctgaggattgacttctgcactaatccagtgaaggaggctgtgtcaaaagaagggctcagaagccctcttttcagaggcaatgattcctgtcagtatgaggtcccttagttactaaaaagggacatgatttaactccagtttgatgaacctcctccgagtttactttattgtcttcaaatcttttgttttcttcctttttgtgagatttgtgggttttgtgccttataaatggaaatgtatgaacacaatatatgctcatgtagaattttctgttctgggttattgggataagaaaaaatatatattgctcttcaactagtgaatgaaagaaacttcagaaagctagaattgcttatcaatcaaaagactttctcaatctattttggccacaaacaaacatattcaactgaagctttccaataatctttatatcaagaaagcatgcgtcttgtcagctacattgttttcttagatggatttctcctgttaatcctcaaatatctgaacttctgtgttacccaagtgtcttatacaagcttctggtgtctaggacaaatttatggcaaataaaattagcaaaactgaactgggttgaactgaacaagaggatgggggaattgtgcaaatacgttgttagtagaaggtcaatttaaaatagggactagaaattatttgaagttttctttattacggattcaaagacttattttgaaagttggaaggagaagggagggaagagagcagaagggaagaaggtgtaagtcaagctcttgaatataactggtggtattgtgggcagagatctttagttcaaatccacgtattttttaaaagagagaaccggaggtagagcaatgatcagatgggtgcacagaccagtgccaatctgaacattgttaatggcctgtgacatgatgagcacaggaacaggcatgaagatattgccatacaattttaatttatacaagtattggcccctcaagtggttggaaattttttttttaatctctttttctgagacagggtcttactctgtcgcccaggctggagtgcagtgatgcaatcacggctcactgcagcctcgacctccccagctcaagcaatcctcccacctcagcctcctaagtacctggtactacaggcgcgtgccaccacacctggctaatttttgcattttttgtagagacagggttttgccacgttgcttaggctggtcttgaactcctgaactcaagtgatccgcccacctcagcctcccaaagtgttgggattacagacattagccatcacgcctgccctagaaacagttttttaataggagatatttgagaggcattgaggtaggagactctatgacatgccctcagaatatcagaatcttcttagaaataaactaggaaatgcagatgtttttaactactcagacttttgaggaattaatccttttaaaacatttttgttaaagttagtgtatcagtaagaaacagacctagtttaaaaggaataatcaacaattttataaaggagatggcttattcaaccatagcccctccaacatatctactggaaattctgctggttaactttatctctctctctcttaatttagactttcaacctatgaaaatgtaaatacctttgaaaaaactaaactatcagtcatttacatcctctcatgaatgaaatgcagtgtagggagaggagatggcaggacacagcaaacaggacacatttgcctgcttctctcttgcctaattcttcctgacctgtatttactgatgcttaataatacttgtaagactctaggggttcatttcccatttcagcggaaagtacttcactcaacaacaatattctcaagagtcttctactggaagctagaaagaaataggaatttaagtccatagaatgaaggtagttattcctgcctgtgttgcccacctgttcacaaaaagtacctttatgcttgaaaacattaggttctttggttactgcactgtagtttcaaatggatcctccagatggcattcatgtcttactcagaaagggcactgccattgtccccaaggcttctgtctactaattctattggtcttgtgttttgcttgcttggcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaatggagctattttctgtctatataaatctacttatatgaataaccattaaagtgattttgtatatgcaaaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:85315 -> Molecular function: GO:0005496 [steroid binding] evidence: IEA
            GeneID:85315 -> Biological process: GO:0007275 [multicellular organismal development] evidence: IEA
            GeneID:85315 -> Biological process: GO:0030154 [cell differentiation] evidence: IEA
            GeneID:85315 -> Biological process: GO:0048477 [oogenesis] evidence: IEA
            GeneID:85315 -> Cellular component: GO:0005886 [plasma membrane] evidence: IEA
            GeneID:85315 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.