GGRNA Home | Help | Advanced search

2024-04-19 12:23:05, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_130844                793 bp    mRNA    linear   PRI 16-JUN-2013
DEFINITION  Homo sapiens WW domain containing oxidoreductase (WWOX), transcript
            variant 3, mRNA.
ACCESSION   NM_130844
VERSION     NM_130844.2  GI:333944036
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 793)
  AUTHORS   Guo,W., Dong,Z., Dong,Y., Guo,Y., Kuang,G. and Yang,Z.
  TITLE     Genetic and epigenetic alterations of WWOX in the development of
            gastric cardia adenocarcinoma
  JOURNAL   Environ. Mol. Mutagen. 54 (2), 112-123 (2013)
   PUBMED   23197378
  REMARK    GeneRIF: WWOX may play an important role in gastric cardia
            adenocarcinoma especially in individuals with upper
            gastrointestinal cancer family history.
REFERENCE   2  (bases 1 to 793)
  AUTHORS   Li,Y.P., Wu,C.C., Chen,W.T., Huang,Y.C. and Chai,C.Y.
  TITLE     The expression and significance of WWOX and beta-catenin in
            hepatocellular carcinoma
  JOURNAL   APMIS 121 (2), 120-126 (2013)
   PUBMED   23030478
  REMARK    GeneRIF: Downregulation of WWOX might lead to accumulation of
            cytoplasmic beta-catenin and the subsequent activation of
            Wnt/beta-catenin signaling pathway in hepatocellular carcinoma.
REFERENCE   3  (bases 1 to 793)
  AUTHORS   Luykx,J.J., Bakker,S.C., Lentjes,E., Neeleman,M., Strengman,E.,
            Mentink,L., Deyoung,J., de Jong,S., Sul,J.H., Eskin,E., van
            Eijk,K., van Setten,J., Buizer-Voskamp,J.E., Cantor,R.M., Lu,A.,
            van Amerongen,M., van Dongen,E.P., Keijzers,P., Kappen,T.,
            Borgdorff,P., Bruins,P., Derks,E.M., Kahn,R.S. and Ophoff,R.A.
  TITLE     Genome-wide association study of monoamine metabolite levels in
            human cerebrospinal fluid
  JOURNAL   Mol. Psychiatry (2013) In press
   PUBMED   23319000
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   4  (bases 1 to 793)
  AUTHORS   Hancock,D.B., Artigas,M.S., Gharib,S.A., Henry,A., Manichaikul,A.,
            Ramasamy,A., Loth,D.W., Imboden,M., Koch,B., McArdle,W.L.,
            Smith,A.V., Smolonska,J., Sood,A., Tang,W., Wilk,J.B., Zhai,G.,
            Zhao,J.H., Aschard,H., Burkart,K.M., Curjuric,I., Eijgelsheim,M.,
            Elliott,P., Gu,X., Harris,T.B., Janson,C., Homuth,G., Hysi,P.G.,
            Liu,J.Z., Loehr,L.R., Lohman,K., Loos,R.J., Manning,A.K.,
            Marciante,K.D., Obeidat,M., Postma,D.S., Aldrich,M.C.,
            Brusselle,G.G., Chen,T.H., Eiriksdottir,G., Franceschini,N.,
            Heinrich,J., Rotter,J.I., Wijmenga,C., Williams,O.D., Bentley,A.R.,
            Hofman,A., Laurie,C.C., Lumley,T., Morrison,A.C., Joubert,B.R.,
            Rivadeneira,F., Couper,D.J., Kritchevsky,S.B., Liu,Y., Wjst,M.,
            Wain,L.V., Vonk,J.M., Uitterlinden,A.G., Rochat,T., Rich,S.S.,
            Psaty,B.M., O'Connor,G.T., North,K.E., Mirel,D.B., Meibohm,B.,
            Launer,L.J., Khaw,K.T., Hartikainen,A.L., Hammond,C.J., Glaser,S.,
            Marchini,J., Kraft,P., Wareham,N.J., Volzke,H., Stricker,B.H.,
            Spector,T.D., Probst-Hensch,N.M., Jarvis,D., Jarvelin,M.R.,
            Heckbert,S.R., Gudnason,V., Boezen,H.M., Barr,R.G., Cassano,P.A.,
            Strachan,D.P., Fornage,M., Hall,I.P., Dupuis,J., Tobin,M.D. and
            London,S.J.
  TITLE     Genome-wide joint meta-analysis of SNP and SNP-by-smoking
            interaction identifies novel loci for pulmonary function
  JOURNAL   PLoS Genet. 8 (12), E1003098 (2012)
   PUBMED   23284291
REFERENCE   5  (bases 1 to 793)
  AUTHORS   Hart,A.B., Engelhardt,B.E., Wardle,M.C., Sokoloff,G., Stephens,M.,
            de Wit,H. and Palmer,A.A.
  TITLE     Genome-wide association study of d-amphetamine response in healthy
            volunteers identifies putative associations, including cadherin 13
            (CDH13)
  JOURNAL   PLoS ONE 7 (8), E42646 (2012)
   PUBMED   22952603
REFERENCE   6  (bases 1 to 793)
  AUTHORS   Bednarek,A.K., Keck-Waggoner,C.L., Daniel,R.L., Laflin,K.J.,
            Bergsagel,P.L., Kiguchi,K., Brenner,A.J. and Aldaz,C.M.
  TITLE     WWOX, the FRA16D gene, behaves as a suppressor of tumor growth
  JOURNAL   Cancer Res. 61 (22), 8068-8073 (2001)
   PUBMED   11719429
  REMARK    GeneRIF: WWOX, the FRA16D gene, behaves as a suppressor of tumor
            growth.
REFERENCE   7  (bases 1 to 793)
  AUTHORS   Paige,A.J., Taylor,K.J., Taylor,C., Hillier,S.G., Farrington,S.,
            Scott,D., Porteous,D.J., Smyth,J.F., Gabra,H. and Watson,J.E.
  TITLE     WWOX: a candidate tumor suppressor gene involved in multiple tumor
            types
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 98 (20), 11417-11422 (2001)
   PUBMED   11572989
REFERENCE   8  (bases 1 to 793)
  AUTHORS   Chang,N.S., Pratt,N., Heath,J., Schultz,L., Sleve,D., Carey,G.B.
            and Zevotek,N.
  TITLE     Hyaluronidase induction of a WW domain-containing oxidoreductase
            that enhances tumor necrosis factor cytotoxicity
  JOURNAL   J. Biol. Chem. 276 (5), 3361-3370 (2001)
   PUBMED   11058590
REFERENCE   9  (bases 1 to 793)
  AUTHORS   Ried,K., Finnis,M., Hobson,L., Mangelsdorf,M., Dayan,S.,
            Nancarrow,J.K., Woollatt,E., Kremmidiotis,G., Gardner,A.,
            Venter,D., Baker,E. and Richards,R.I.
  TITLE     Common chromosomal fragile site FRA16D sequence: identification of
            the FOR gene spanning FRA16D and homozygous deletions and
            translocation breakpoints in cancer cells
  JOURNAL   Hum. Mol. Genet. 9 (11), 1651-1663 (2000)
   PUBMED   10861292
REFERENCE   10 (bases 1 to 793)
  AUTHORS   Bednarek,A.K., Laflin,K.J., Daniel,R.L., Liao,Q., Hawkins,K.A. and
            Aldaz,C.M.
  TITLE     WWOX, a novel WW domain-containing protein mapping to human
            chromosome 16q23.3-24.1, a region frequently affected in breast
            cancer
  JOURNAL   Cancer Res. 60 (8), 2140-2145 (2000)
   PUBMED   10786676
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DB035405.1, AF227529.1 and
            AW874693.1.
            On May 25, 2011 this sequence version replaced gi:18860887.
            
            Summary: WW domain-containing proteins are found in all eukaryotes
            and play an important role in the regulation of a wide variety of
            cellular functions such as protein degradation, transcription, and
            RNA splicing. This gene encodes a protein which contains 2 WW
            domains and a short-chain dehydrogenase/reductase domain (SRD). The
            highest normal expression of this gene is detected in hormonally
            regulated tissues such as testis, ovary, and prostate. This
            expression pattern and the presence of an SRD domain suggest a role
            for this gene in steroid metabolism. The encoded protein is more
            than 90% identical to the mouse protein, which is an essential
            mediator of tumor necrosis factor-alpha-induced apoptosis,
            suggesting a similar, important role in apoptosis for the human
            protein. In addition, there is evidence that this gene behaves as a
            suppressor of tumor growth. Alternative splicing of this gene
            generates transcript variants that encode different isoforms.
            [provided by RefSeq, Jul 2008].
            
            Transcript Variant: This variant (3) has a much shorter and
            alternate 3' end, as compared to variant 1. It encodes the shortest
            isoform (3) which contains only part of the first WW domain and
            lacks the second WW domain and the SRD region.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-245               DB035405.1         18-262
            246-753             AF227529.1         1-508
            754-793             AW874693.1         750-789
FEATURES             Location/Qualifiers
     source          1..793
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="16"
                     /map="16q23.3-q24.1"
     gene            1..793
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /note="WW domain containing oxidoreductase"
                     /db_xref="GeneID:51741"
                     /db_xref="HGNC:12799"
                     /db_xref="HPRD:05501"
                     /db_xref="MIM:605131"
     exon            1..770
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /inference="alignment:Splign:1.39.8"
     variation       24
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:117763255"
     variation       51
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188079701"
     variation       219
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:191298606"
     variation       298
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:375359239"
     variation       311
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:377066400"
     misc_feature    320..322
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /note="upstream in-frame stop codon"
     variation       334
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368929558"
     variation       345
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11545028"
     CDS             350..460
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /EC_number="1.1.1.-"
                     /note="isoform 3 is encoded by transcript variant 3; short
                     chain dehydrogenase/reductase family 41C, member 1; WW
                     domain-containing protein WWOX; fragile site FRA16D
                     oxidoreductase"
                     /codon_start=1
                     /product="WW domain-containing oxidoreductase isoform 3"
                     /protein_id="NP_570859.1"
                     /db_xref="GI:18860888"
                     /db_xref="CCDS:CCDS58481.1"
                     /db_xref="GeneID:51741"
                     /db_xref="HGNC:12799"
                     /db_xref="HPRD:05501"
                     /db_xref="MIM:605131"
                     /translation="
MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYAK
"
     misc_feature    389..391
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    401..>451
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /note="Two conserved tryptophans domain; also known as the
                     WWP or rsp5 domain; around 40 amino acids; functions as an
                     interaction module in a diverse set of signalling
                     proteins; binds specific proline-rich sequences but at low
                     affinities compared to other...; Region: WW; cl00157"
                     /db_xref="CDD:241647"
     misc_feature    446..448
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /note="binding pocket"
                     /db_xref="CDD:238122"
     misc_feature    446..448
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    446..448
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:01819"
     variation       368
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371392600"
     variation       379
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373146723"
     variation       409
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376165565"
     variation       469
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373944829"
     variation       474
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146301453"
     variation       488
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:374586323"
     variation       541
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183585438"
     variation       625
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:187451868"
     variation       708
                     /gene="WWOX"
                     /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128;
                     SDR41C1; WOX1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:58108921"
ORIGIN      
gatgcgcacgccccttccctgcggcggggaggctgacaaggctccgctctatctctagcgcctcggagcgctctccggctttgctgtctagcccggcggcagcgcgatctcttaggcactttcaccgccttcctctccaggccctgcccctttgacgccggccgtcgcgatattgcggagactggatttcagcttcgtggtcggcggagcggcccctggagggcgcagtgcgcaggcgtgagcggtcgggccccgacgcgcgcgggtctcgtttggagcgggagtgagttcctgagcgagtggacccggcagcgggcgataggggggccaggtgcctccacagtcagccatggcagcgctgcgctacgcggggctggacgacacggacagtgaggacgagctgcctccgggctgggaggagagaaccaccaaggacggctgggtttactacgccaagtaagggggccgcagtggggccgcggacgcacctgggaccctgcacagcccacggacgccacctgcgcggggaggacgcgcactccagcgcagcgcgtgcggtgcaaagtgaaagtaactgttaaggagcttcagggaaaagggtccagggttcccagtaggggccggcccccttggtgggcctcgggtccagcgggggtcacctggtggcttcccggcgcgccctctgctgttcaggatgcagcactgcgcggcgcggcgagggcaaagcggcctcatccccgccaaaaaataaagatgttttaaaaagcgcaaaaaaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:51741 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:51741 -> Molecular function: GO:0016491 [oxidoreductase activity] evidence: NAS
            GeneID:51741 -> Molecular function: GO:0016491 [oxidoreductase activity] evidence: TAS
            GeneID:51741 -> Molecular function: GO:0019899 [enzyme binding] evidence: IPI
            GeneID:51741 -> Molecular function: GO:0046983 [protein dimerization activity] evidence: TAS
            GeneID:51741 -> Molecular function: GO:0048037 [cofactor binding] evidence: TAS
            GeneID:51741 -> Molecular function: GO:0050662 [coenzyme binding] evidence: TAS
            GeneID:51741 -> Biological process: GO:0001649 [osteoblast differentiation] evidence: IEA
            GeneID:51741 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
            GeneID:51741 -> Biological process: GO:0006917 [induction of apoptosis] evidence: IEA
            GeneID:51741 -> Biological process: GO:0008202 [steroid metabolic process] evidence: TAS
            GeneID:51741 -> Biological process: GO:0016055 [Wnt receptor signaling pathway] evidence: IEA
            GeneID:51741 -> Biological process: GO:0030178 [negative regulation of Wnt receptor signaling pathway] evidence: IDA
            GeneID:51741 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: ISS
            GeneID:51741 -> Biological process: GO:0048705 [skeletal system morphogenesis] evidence: ISS
            GeneID:51741 -> Biological process: GO:0055114 [oxidation-reduction process] evidence: TAS
            GeneID:51741 -> Biological process: GO:0071560 [cellular response to transforming growth factor beta stimulus] evidence: IDA
            GeneID:51741 -> Biological process: GO:2001238 [positive regulation of extrinsic apoptotic signaling pathway] evidence: ISS
            GeneID:51741 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
            GeneID:51741 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
            GeneID:51741 -> Cellular component: GO:0005737 [cytoplasm] evidence: TAS
            GeneID:51741 -> Cellular component: GO:0005739 [mitochondrion] evidence: ISS
            GeneID:51741 -> Cellular component: GO:0005794 [Golgi apparatus] evidence: IDA
            GeneID:51741 -> Cellular component: GO:0005829 [cytosol] evidence: IDA
            GeneID:51741 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
            GeneID:51741 -> Cellular component: GO:0005886 [plasma membrane] evidence: IDA
            GeneID:51741 -> Cellular component: GO:0005902 [microvillus] evidence: IDA
ANNOTATIONS from NCBI Entrez Gene (20130726):
            NP_570859 -> EC 1.1.1.-

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.