2024-04-19 12:23:05, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_130844 793 bp mRNA linear PRI 16-JUN-2013 DEFINITION Homo sapiens WW domain containing oxidoreductase (WWOX), transcript variant 3, mRNA. ACCESSION NM_130844 VERSION NM_130844.2 GI:333944036 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 793) AUTHORS Guo,W., Dong,Z., Dong,Y., Guo,Y., Kuang,G. and Yang,Z. TITLE Genetic and epigenetic alterations of WWOX in the development of gastric cardia adenocarcinoma JOURNAL Environ. Mol. Mutagen. 54 (2), 112-123 (2013) PUBMED 23197378 REMARK GeneRIF: WWOX may play an important role in gastric cardia adenocarcinoma especially in individuals with upper gastrointestinal cancer family history. REFERENCE 2 (bases 1 to 793) AUTHORS Li,Y.P., Wu,C.C., Chen,W.T., Huang,Y.C. and Chai,C.Y. TITLE The expression and significance of WWOX and beta-catenin in hepatocellular carcinoma JOURNAL APMIS 121 (2), 120-126 (2013) PUBMED 23030478 REMARK GeneRIF: Downregulation of WWOX might lead to accumulation of cytoplasmic beta-catenin and the subsequent activation of Wnt/beta-catenin signaling pathway in hepatocellular carcinoma. REFERENCE 3 (bases 1 to 793) AUTHORS Luykx,J.J., Bakker,S.C., Lentjes,E., Neeleman,M., Strengman,E., Mentink,L., Deyoung,J., de Jong,S., Sul,J.H., Eskin,E., van Eijk,K., van Setten,J., Buizer-Voskamp,J.E., Cantor,R.M., Lu,A., van Amerongen,M., van Dongen,E.P., Keijzers,P., Kappen,T., Borgdorff,P., Bruins,P., Derks,E.M., Kahn,R.S. and Ophoff,R.A. TITLE Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid JOURNAL Mol. Psychiatry (2013) In press PUBMED 23319000 REMARK Publication Status: Available-Online prior to print REFERENCE 4 (bases 1 to 793) AUTHORS Hancock,D.B., Artigas,M.S., Gharib,S.A., Henry,A., Manichaikul,A., Ramasamy,A., Loth,D.W., Imboden,M., Koch,B., McArdle,W.L., Smith,A.V., Smolonska,J., Sood,A., Tang,W., Wilk,J.B., Zhai,G., Zhao,J.H., Aschard,H., Burkart,K.M., Curjuric,I., Eijgelsheim,M., Elliott,P., Gu,X., Harris,T.B., Janson,C., Homuth,G., Hysi,P.G., Liu,J.Z., Loehr,L.R., Lohman,K., Loos,R.J., Manning,A.K., Marciante,K.D., Obeidat,M., Postma,D.S., Aldrich,M.C., Brusselle,G.G., Chen,T.H., Eiriksdottir,G., Franceschini,N., Heinrich,J., Rotter,J.I., Wijmenga,C., Williams,O.D., Bentley,A.R., Hofman,A., Laurie,C.C., Lumley,T., Morrison,A.C., Joubert,B.R., Rivadeneira,F., Couper,D.J., Kritchevsky,S.B., Liu,Y., Wjst,M., Wain,L.V., Vonk,J.M., Uitterlinden,A.G., Rochat,T., Rich,S.S., Psaty,B.M., O'Connor,G.T., North,K.E., Mirel,D.B., Meibohm,B., Launer,L.J., Khaw,K.T., Hartikainen,A.L., Hammond,C.J., Glaser,S., Marchini,J., Kraft,P., Wareham,N.J., Volzke,H., Stricker,B.H., Spector,T.D., Probst-Hensch,N.M., Jarvis,D., Jarvelin,M.R., Heckbert,S.R., Gudnason,V., Boezen,H.M., Barr,R.G., Cassano,P.A., Strachan,D.P., Fornage,M., Hall,I.P., Dupuis,J., Tobin,M.D. and London,S.J. TITLE Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function JOURNAL PLoS Genet. 8 (12), E1003098 (2012) PUBMED 23284291 REFERENCE 5 (bases 1 to 793) AUTHORS Hart,A.B., Engelhardt,B.E., Wardle,M.C., Sokoloff,G., Stephens,M., de Wit,H. and Palmer,A.A. TITLE Genome-wide association study of d-amphetamine response in healthy volunteers identifies putative associations, including cadherin 13 (CDH13) JOURNAL PLoS ONE 7 (8), E42646 (2012) PUBMED 22952603 REFERENCE 6 (bases 1 to 793) AUTHORS Bednarek,A.K., Keck-Waggoner,C.L., Daniel,R.L., Laflin,K.J., Bergsagel,P.L., Kiguchi,K., Brenner,A.J. and Aldaz,C.M. TITLE WWOX, the FRA16D gene, behaves as a suppressor of tumor growth JOURNAL Cancer Res. 61 (22), 8068-8073 (2001) PUBMED 11719429 REMARK GeneRIF: WWOX, the FRA16D gene, behaves as a suppressor of tumor growth. REFERENCE 7 (bases 1 to 793) AUTHORS Paige,A.J., Taylor,K.J., Taylor,C., Hillier,S.G., Farrington,S., Scott,D., Porteous,D.J., Smyth,J.F., Gabra,H. and Watson,J.E. TITLE WWOX: a candidate tumor suppressor gene involved in multiple tumor types JOURNAL Proc. Natl. Acad. Sci. U.S.A. 98 (20), 11417-11422 (2001) PUBMED 11572989 REFERENCE 8 (bases 1 to 793) AUTHORS Chang,N.S., Pratt,N., Heath,J., Schultz,L., Sleve,D., Carey,G.B. and Zevotek,N. TITLE Hyaluronidase induction of a WW domain-containing oxidoreductase that enhances tumor necrosis factor cytotoxicity JOURNAL J. Biol. Chem. 276 (5), 3361-3370 (2001) PUBMED 11058590 REFERENCE 9 (bases 1 to 793) AUTHORS Ried,K., Finnis,M., Hobson,L., Mangelsdorf,M., Dayan,S., Nancarrow,J.K., Woollatt,E., Kremmidiotis,G., Gardner,A., Venter,D., Baker,E. and Richards,R.I. TITLE Common chromosomal fragile site FRA16D sequence: identification of the FOR gene spanning FRA16D and homozygous deletions and translocation breakpoints in cancer cells JOURNAL Hum. Mol. Genet. 9 (11), 1651-1663 (2000) PUBMED 10861292 REFERENCE 10 (bases 1 to 793) AUTHORS Bednarek,A.K., Laflin,K.J., Daniel,R.L., Liao,Q., Hawkins,K.A. and Aldaz,C.M. TITLE WWOX, a novel WW domain-containing protein mapping to human chromosome 16q23.3-24.1, a region frequently affected in breast cancer JOURNAL Cancer Res. 60 (8), 2140-2145 (2000) PUBMED 10786676 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DB035405.1, AF227529.1 and AW874693.1. On May 25, 2011 this sequence version replaced gi:18860887. Summary: WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 2 WW domains and a short-chain dehydrogenase/reductase domain (SRD). The highest normal expression of this gene is detected in hormonally regulated tissues such as testis, ovary, and prostate. This expression pattern and the presence of an SRD domain suggest a role for this gene in steroid metabolism. The encoded protein is more than 90% identical to the mouse protein, which is an essential mediator of tumor necrosis factor-alpha-induced apoptosis, suggesting a similar, important role in apoptosis for the human protein. In addition, there is evidence that this gene behaves as a suppressor of tumor growth. Alternative splicing of this gene generates transcript variants that encode different isoforms. [provided by RefSeq, Jul 2008]. Transcript Variant: This variant (3) has a much shorter and alternate 3' end, as compared to variant 1. It encodes the shortest isoform (3) which contains only part of the first WW domain and lacks the second WW domain and the SRD region. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. COMPLETENESS: full length. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-245 DB035405.1 18-262 246-753 AF227529.1 1-508 754-793 AW874693.1 750-789 FEATURES Location/Qualifiers source 1..793 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="16" /map="16q23.3-q24.1" gene 1..793 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /note="WW domain containing oxidoreductase" /db_xref="GeneID:51741" /db_xref="HGNC:12799" /db_xref="HPRD:05501" /db_xref="MIM:605131" exon 1..770 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /inference="alignment:Splign:1.39.8" variation 24 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /replace="a" /replace="g" /db_xref="dbSNP:117763255" variation 51 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /replace="a" /replace="g" /db_xref="dbSNP:188079701" variation 219 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /replace="g" /replace="t" /db_xref="dbSNP:191298606" variation 298 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /replace="c" /replace="g" /db_xref="dbSNP:375359239" variation 311 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /replace="a" /replace="t" /db_xref="dbSNP:377066400" misc_feature 320..322 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /note="upstream in-frame stop codon" variation 334 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /replace="a" /replace="g" /db_xref="dbSNP:368929558" variation 345 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /replace="c" /replace="t" /db_xref="dbSNP:11545028" CDS 350..460 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /EC_number="1.1.1.-" /note="isoform 3 is encoded by transcript variant 3; short chain dehydrogenase/reductase family 41C, member 1; WW domain-containing protein WWOX; fragile site FRA16D oxidoreductase" /codon_start=1 /product="WW domain-containing oxidoreductase isoform 3" /protein_id="NP_570859.1" /db_xref="GI:18860888" /db_xref="CCDS:CCDS58481.1" /db_xref="GeneID:51741" /db_xref="HGNC:12799" /db_xref="HPRD:05501" /db_xref="MIM:605131" /translation="
MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYAK
" misc_feature 389..391 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" misc_feature 401..>451 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /note="Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other...; Region: WW; cl00157" /db_xref="CDD:241647" misc_feature 446..448 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /note="binding pocket" /db_xref="CDD:238122" misc_feature 446..448 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" misc_feature 446..448 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:01819" variation 368 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /replace="a" /replace="g" /db_xref="dbSNP:371392600" variation 379 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /replace="c" /replace="t" /db_xref="dbSNP:373146723" variation 409 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /replace="c" /replace="g" /db_xref="dbSNP:376165565" variation 469 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /replace="c" /replace="t" /db_xref="dbSNP:373944829" variation 474 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /replace="a" /replace="g" /db_xref="dbSNP:146301453" variation 488 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /replace="a" /replace="c" /db_xref="dbSNP:374586323" variation 541 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /replace="c" /replace="t" /db_xref="dbSNP:183585438" variation 625 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /replace="c" /replace="t" /db_xref="dbSNP:187451868" variation 708 /gene="WWOX" /gene_synonym="D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SDR41C1; WOX1" /replace="c" /replace="t" /db_xref="dbSNP:58108921" ORIGIN
gatgcgcacgccccttccctgcggcggggaggctgacaaggctccgctctatctctagcgcctcggagcgctctccggctttgctgtctagcccggcggcagcgcgatctcttaggcactttcaccgccttcctctccaggccctgcccctttgacgccggccgtcgcgatattgcggagactggatttcagcttcgtggtcggcggagcggcccctggagggcgcagtgcgcaggcgtgagcggtcgggccccgacgcgcgcgggtctcgtttggagcgggagtgagttcctgagcgagtggacccggcagcgggcgataggggggccaggtgcctccacagtcagccatggcagcgctgcgctacgcggggctggacgacacggacagtgaggacgagctgcctccgggctgggaggagagaaccaccaaggacggctgggtttactacgccaagtaagggggccgcagtggggccgcggacgcacctgggaccctgcacagcccacggacgccacctgcgcggggaggacgcgcactccagcgcagcgcgtgcggtgcaaagtgaaagtaactgttaaggagcttcagggaaaagggtccagggttcccagtaggggccggcccccttggtgggcctcgggtccagcgggggtcacctggtggcttcccggcgcgccctctgctgttcaggatgcagcactgcgcggcgcggcgagggcaaagcggcctcatccccgccaaaaaataaagatgttttaaaaagcgcaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:51741 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:51741 -> Molecular function: GO:0016491 [oxidoreductase activity] evidence: NAS GeneID:51741 -> Molecular function: GO:0016491 [oxidoreductase activity] evidence: TAS GeneID:51741 -> Molecular function: GO:0019899 [enzyme binding] evidence: IPI GeneID:51741 -> Molecular function: GO:0046983 [protein dimerization activity] evidence: TAS GeneID:51741 -> Molecular function: GO:0048037 [cofactor binding] evidence: TAS GeneID:51741 -> Molecular function: GO:0050662 [coenzyme binding] evidence: TAS GeneID:51741 -> Biological process: GO:0001649 [osteoblast differentiation] evidence: IEA GeneID:51741 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA GeneID:51741 -> Biological process: GO:0006917 [induction of apoptosis] evidence: IEA GeneID:51741 -> Biological process: GO:0008202 [steroid metabolic process] evidence: TAS GeneID:51741 -> Biological process: GO:0016055 [Wnt receptor signaling pathway] evidence: IEA GeneID:51741 -> Biological process: GO:0030178 [negative regulation of Wnt receptor signaling pathway] evidence: IDA GeneID:51741 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: ISS GeneID:51741 -> Biological process: GO:0048705 [skeletal system morphogenesis] evidence: ISS GeneID:51741 -> Biological process: GO:0055114 [oxidation-reduction process] evidence: TAS GeneID:51741 -> Biological process: GO:0071560 [cellular response to transforming growth factor beta stimulus] evidence: IDA GeneID:51741 -> Biological process: GO:2001238 [positive regulation of extrinsic apoptotic signaling pathway] evidence: ISS GeneID:51741 -> Cellular component: GO:0005634 [nucleus] evidence: IDA GeneID:51741 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA GeneID:51741 -> Cellular component: GO:0005737 [cytoplasm] evidence: TAS GeneID:51741 -> Cellular component: GO:0005739 [mitochondrion] evidence: ISS GeneID:51741 -> Cellular component: GO:0005794 [Golgi apparatus] evidence: IDA GeneID:51741 -> Cellular component: GO:0005829 [cytosol] evidence: IDA GeneID:51741 -> Cellular component: GO:0005829 [cytosol] evidence: TAS GeneID:51741 -> Cellular component: GO:0005886 [plasma membrane] evidence: IDA GeneID:51741 -> Cellular component: GO:0005902 [microvillus] evidence: IDA ANNOTATIONS from NCBI Entrez Gene (20130726): NP_570859 -> EC 1.1.1.-
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.