GGRNA Home | Help | Advanced search

2024-04-25 10:01:48, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_130769                774 bp    mRNA    linear   PRI 13-APR-2013
DEFINITION  Homo sapiens glycoprotein hormone alpha 2 (GPHA2), mRNA.
ACCESSION   NM_130769
VERSION     NM_130769.3  GI:189491650
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 774)
  AUTHORS   Okajima,Y., Nagasaki,H., Suzuki,C., Suga,H., Ozaki,N., Arima,H.,
            Hamada,Y., Civelli,O. and Oiso,Y.
  TITLE     Biochemical roles of the oligosaccharide chains in thyrostimulin, a
            heterodimeric hormone of glycoprotein hormone subunits alpha 2
            (GPA2) and beta 5 (GPB5)
  JOURNAL   Regul. Pept. 148 (1-3), 62-67 (2008)
   PUBMED   18433898
  REMARK    GeneRIF: Dual site-disrupted GPA2 and the GPB5 mutant were not
            expressed in either the conditioned medium or cell lysate.
REFERENCE   2  (bases 1 to 774)
  AUTHORS   Suzuki,C., Nagasaki,H., Okajima,Y., Suga,H., Arima,H., Iwasaki,Y.
            and Oiso,Y.
  TITLE     The LIM domain homeobox gene isl-1 is a positive regulator of
            glycoprotein alpha 2 (GPA2), a subunit of thyrostimulin
  JOURNAL   Regul. Pept. 142 (1-2), 60-67 (2007)
   PUBMED   17363077
  REMARK    GeneRIF: Sudy illustrated that GPA2 is positively regulated by
            isl-1, suggesting that this protein associates with endocrine
            systems including the pituitary and pancreas.
REFERENCE   3  (bases 1 to 774)
  AUTHORS   Breous,E., Wenzel,A. and Loos,U.
  TITLE     Promoter cloning and characterisation of the transcriptional
            regulation of the human thyrostimulin A2 subunit
  JOURNAL   Mol. Cell. Endocrinol. 245 (1-2), 169-180 (2005)
   PUBMED   16376481
  REMARK    GeneRIF: cloning and functional analysis of the promoter of the
            thyrostimulin A2 subunit
REFERENCE   4  (bases 1 to 774)
  AUTHORS   Sudo,S., Kuwabara,Y., Park,J.I., Hsu,S.Y. and Hsueh,A.J.
  TITLE     Heterodimeric fly glycoprotein hormone-alpha2 (GPA2) and
            glycoprotein hormone-beta5 (GPB5) activate fly leucine-rich
            repeat-containing G protein-coupled receptor-1 (DLGR1) and
            stimulation of human thyrotropin receptors by chimeric fly GPA2 and
            human GPB5
  JOURNAL   Endocrinology 146 (8), 3596-3604 (2005)
   PUBMED   15890769
  REMARK    GeneRIF: GPA2, and another beta-subunit, GPB5, in human, are
            capable of forming heterodimers to activate TSH receptors.
REFERENCE   5  (bases 1 to 774)
  AUTHORS   Hsu,S.Y., Nakabayashi,K. and Bhalla,A.
  TITLE     Evolution of glycoprotein hormone subunit genes in bilateral
            metazoa: identification of two novel human glycoprotein hormone
            subunit family genes, GPA2 and GPB5
  JOURNAL   Mol. Endocrinol. 16 (7), 1538-1551 (2002)
   PUBMED   12089349
  REMARK    GeneRIF: identification and characterization of GPA2 genes
REFERENCE   6  (bases 1 to 774)
  AUTHORS   Nakabayashi,K., Matsumi,H., Bhalla,A., Bae,J., Mosselman,S.,
            Hsu,S.Y. and Hsueh,A.J.
  TITLE     Thyrostimulin, a heterodimer of two new human glycoprotein hormone
            subunits, activates the thyroid-stimulating hormone receptor
  JOURNAL   J. Clin. Invest. 109 (11), 1445-1452 (2002)
   PUBMED   12045258
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AF260739.1 and AP001187.5.
            On Jun 7, 2008 this sequence version replaced gi:24475778.
            
            Summary: GPHA2 is a cystine knot-forming polypeptide and a subunit
            of the dimeric glycoprotein hormone family (Hsu et al., 2002
            [PubMed 12089349]).[supplied by OMIM, Mar 2008].
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF260739.1, BI839000.1 [ECO:0000332]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-489               AF260739.1         1-489
            490-490             AP001187.5         140528-140528       c
            491-774             AF260739.1         491-774
FEATURES             Location/Qualifiers
     source          1..774
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="11"
                     /map="11q13.1"
     gene            1..774
                     /gene="GPHA2"
                     /gene_synonym="A2; GPA2; ZSIG51"
                     /note="glycoprotein hormone alpha 2"
                     /db_xref="GeneID:170589"
                     /db_xref="HGNC:18054"
                     /db_xref="HPRD:17052"
                     /db_xref="MIM:609651"
     exon            1..55
                     /gene="GPHA2"
                     /gene_synonym="A2; GPA2; ZSIG51"
                     /inference="alignment:Splign:1.39.8"
     STS             6..495
                     /gene="GPHA2"
                     /gene_synonym="A2; GPA2; ZSIG51"
                     /db_xref="UniSTS:481495"
     STS             26..476
                     /gene="GPHA2"
                     /gene_synonym="A2; GPA2; ZSIG51"
                     /db_xref="UniSTS:483682"
     CDS             56..445
                     /gene="GPHA2"
                     /gene_synonym="A2; GPA2; ZSIG51"
                     /note="cysteine knot protein; glycoprotein alpha 2;
                     glycoprotein hormone alpha-2; thyrostimulin subunit alpha;
                     putative secreted protein Zsig51"
                     /codon_start=1
                     /product="glycoprotein hormone alpha-2 precursor"
                     /protein_id="NP_570125.1"
                     /db_xref="GI:18640742"
                     /db_xref="CCDS:CCDS8086.1"
                     /db_xref="GeneID:170589"
                     /db_xref="HGNC:18054"
                     /db_xref="HPRD:17052"
                     /db_xref="MIM:609651"
                     /translation="
MPMASPQTLVLYLLVLAVTEAWGQEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY
"
     sig_peptide     56..124
                     /gene="GPHA2"
                     /gene_synonym="A2; GPA2; ZSIG51"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     mat_peptide     125..442
                     /gene="GPHA2"
                     /gene_synonym="A2; GPA2; ZSIG51"
                     /product="Glycoprotein hormone alpha-2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q96T91.1)"
     exon            56..158
                     /gene="GPHA2"
                     /gene_synonym="A2; GPA2; ZSIG51"
                     /inference="alignment:Splign:1.39.8"
     exon            159..343
                     /gene="GPHA2"
                     /gene_synonym="A2; GPA2; ZSIG51"
                     /inference="alignment:Splign:1.39.8"
     exon            344..747
                     /gene="GPHA2"
                     /gene_synonym="A2; GPA2; ZSIG51"
                     /inference="alignment:Splign:1.39.8"
     variation       490
                     /gene="GPHA2"
                     /gene_synonym="A2; GPA2; ZSIG51"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:673995"
     variation       496
                     /gene="GPHA2"
                     /gene_synonym="A2; GPA2; ZSIG51"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1055112"
     variation       648
                     /gene="GPHA2"
                     /gene_synonym="A2; GPA2; ZSIG51"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3168083"
     variation       654
                     /gene="GPHA2"
                     /gene_synonym="A2; GPA2; ZSIG51"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3178482"
     variation       678
                     /gene="GPHA2"
                     /gene_synonym="A2; GPA2; ZSIG51"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3178483"
ORIGIN      
ccagcaggaggcacaggaaaactgcaagccgctctgttcctgggcctcggaagtgatgcctatggcgtcccctcaaaccctggtcctctatctgctggtcctggcagtcactgaagcctggggccaggaggcagtcatcccaggctgccacttgcaccccttcaatgtgacagtgcgaagtgaccgccaaggcacctgccagggctcccacgtggcacaggcctgtgtgggccactgtgagtccagcgccttcccttctcggtactctgtgctggtggccagtggttaccgacacaacatcacctccgtctctcagtgctgcaccatcagtggcctgaagaaggtcaaagtacagctgcagtgtgtggggagccggagggaggagctcgagatcttcacggccagggcctgccagtgtgacatgtgtcgcctctctcgctactagcccatcctctcccctccttcctcccctgggtcacagggcttgacgttctggtgggggaaacctgtgttcaagattcaaaaactggaaggagctccagccctgatggttacttgctatggaatttttttaaataaggggagggttgttccagctttgatcctttgtaagattttgtgactgtcacctgagaagaggggagtttctgcttcttccctgcctctgcctggcccttctaaaccaatctttcatcattttacttccctctttgcccttacccctaaataaagcaagcagttcttgaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:170589 -> Molecular function: GO:0005179 [hormone activity] evidence: IEA
            GeneID:170589 -> Cellular component: GO:0005576 [extracellular region] evidence: IDA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.