2025-07-03 12:13:59, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_130769 774 bp mRNA linear PRI 13-APR-2013 DEFINITION Homo sapiens glycoprotein hormone alpha 2 (GPHA2), mRNA. ACCESSION NM_130769 VERSION NM_130769.3 GI:189491650 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 774) AUTHORS Okajima,Y., Nagasaki,H., Suzuki,C., Suga,H., Ozaki,N., Arima,H., Hamada,Y., Civelli,O. and Oiso,Y. TITLE Biochemical roles of the oligosaccharide chains in thyrostimulin, a heterodimeric hormone of glycoprotein hormone subunits alpha 2 (GPA2) and beta 5 (GPB5) JOURNAL Regul. Pept. 148 (1-3), 62-67 (2008) PUBMED 18433898 REMARK GeneRIF: Dual site-disrupted GPA2 and the GPB5 mutant were not expressed in either the conditioned medium or cell lysate. REFERENCE 2 (bases 1 to 774) AUTHORS Suzuki,C., Nagasaki,H., Okajima,Y., Suga,H., Arima,H., Iwasaki,Y. and Oiso,Y. TITLE The LIM domain homeobox gene isl-1 is a positive regulator of glycoprotein alpha 2 (GPA2), a subunit of thyrostimulin JOURNAL Regul. Pept. 142 (1-2), 60-67 (2007) PUBMED 17363077 REMARK GeneRIF: Sudy illustrated that GPA2 is positively regulated by isl-1, suggesting that this protein associates with endocrine systems including the pituitary and pancreas. REFERENCE 3 (bases 1 to 774) AUTHORS Breous,E., Wenzel,A. and Loos,U. TITLE Promoter cloning and characterisation of the transcriptional regulation of the human thyrostimulin A2 subunit JOURNAL Mol. Cell. Endocrinol. 245 (1-2), 169-180 (2005) PUBMED 16376481 REMARK GeneRIF: cloning and functional analysis of the promoter of the thyrostimulin A2 subunit REFERENCE 4 (bases 1 to 774) AUTHORS Sudo,S., Kuwabara,Y., Park,J.I., Hsu,S.Y. and Hsueh,A.J. TITLE Heterodimeric fly glycoprotein hormone-alpha2 (GPA2) and glycoprotein hormone-beta5 (GPB5) activate fly leucine-rich repeat-containing G protein-coupled receptor-1 (DLGR1) and stimulation of human thyrotropin receptors by chimeric fly GPA2 and human GPB5 JOURNAL Endocrinology 146 (8), 3596-3604 (2005) PUBMED 15890769 REMARK GeneRIF: GPA2, and another beta-subunit, GPB5, in human, are capable of forming heterodimers to activate TSH receptors. REFERENCE 5 (bases 1 to 774) AUTHORS Hsu,S.Y., Nakabayashi,K. and Bhalla,A. TITLE Evolution of glycoprotein hormone subunit genes in bilateral metazoa: identification of two novel human glycoprotein hormone subunit family genes, GPA2 and GPB5 JOURNAL Mol. Endocrinol. 16 (7), 1538-1551 (2002) PUBMED 12089349 REMARK GeneRIF: identification and characterization of GPA2 genes REFERENCE 6 (bases 1 to 774) AUTHORS Nakabayashi,K., Matsumi,H., Bhalla,A., Bae,J., Mosselman,S., Hsu,S.Y. and Hsueh,A.J. TITLE Thyrostimulin, a heterodimer of two new human glycoprotein hormone subunits, activates the thyroid-stimulating hormone receptor JOURNAL J. Clin. Invest. 109 (11), 1445-1452 (2002) PUBMED 12045258 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AF260739.1 and AP001187.5. On Jun 7, 2008 this sequence version replaced gi:24475778. Summary: GPHA2 is a cystine knot-forming polypeptide and a subunit of the dimeric glycoprotein hormone family (Hsu et al., 2002 [PubMed 12089349]).[supplied by OMIM, Mar 2008]. ##Evidence-Data-START## Transcript exon combination :: AF260739.1, BI839000.1 [ECO:0000332] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-489 AF260739.1 1-489 490-490 AP001187.5 140528-140528 c 491-774 AF260739.1 491-774 FEATURES Location/Qualifiers source 1..774 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="11" /map="11q13.1" gene 1..774 /gene="GPHA2" /gene_synonym="A2; GPA2; ZSIG51" /note="glycoprotein hormone alpha 2" /db_xref="GeneID:170589" /db_xref="HGNC:18054" /db_xref="HPRD:17052" /db_xref="MIM:609651" exon 1..55 /gene="GPHA2" /gene_synonym="A2; GPA2; ZSIG51" /inference="alignment:Splign:1.39.8" STS 6..495 /gene="GPHA2" /gene_synonym="A2; GPA2; ZSIG51" /db_xref="UniSTS:481495" STS 26..476 /gene="GPHA2" /gene_synonym="A2; GPA2; ZSIG51" /db_xref="UniSTS:483682" CDS 56..445 /gene="GPHA2" /gene_synonym="A2; GPA2; ZSIG51" /note="cysteine knot protein; glycoprotein alpha 2; glycoprotein hormone alpha-2; thyrostimulin subunit alpha; putative secreted protein Zsig51" /codon_start=1 /product="glycoprotein hormone alpha-2 precursor" /protein_id="NP_570125.1" /db_xref="GI:18640742" /db_xref="CCDS:CCDS8086.1" /db_xref="GeneID:170589" /db_xref="HGNC:18054" /db_xref="HPRD:17052" /db_xref="MIM:609651" /translation="
MPMASPQTLVLYLLVLAVTEAWGQEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY
" sig_peptide 56..124 /gene="GPHA2" /gene_synonym="A2; GPA2; ZSIG51" /inference="COORDINATES: ab initio prediction:SignalP:4.0" mat_peptide 125..442 /gene="GPHA2" /gene_synonym="A2; GPA2; ZSIG51" /product="Glycoprotein hormone alpha-2" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q96T91.1)" exon 56..158 /gene="GPHA2" /gene_synonym="A2; GPA2; ZSIG51" /inference="alignment:Splign:1.39.8" exon 159..343 /gene="GPHA2" /gene_synonym="A2; GPA2; ZSIG51" /inference="alignment:Splign:1.39.8" exon 344..747 /gene="GPHA2" /gene_synonym="A2; GPA2; ZSIG51" /inference="alignment:Splign:1.39.8" variation 490 /gene="GPHA2" /gene_synonym="A2; GPA2; ZSIG51" /replace="a" /replace="g" /db_xref="dbSNP:673995" variation 496 /gene="GPHA2" /gene_synonym="A2; GPA2; ZSIG51" /replace="g" /replace="t" /db_xref="dbSNP:1055112" variation 648 /gene="GPHA2" /gene_synonym="A2; GPA2; ZSIG51" /replace="c" /replace="t" /db_xref="dbSNP:3168083" variation 654 /gene="GPHA2" /gene_synonym="A2; GPA2; ZSIG51" /replace="c" /replace="t" /db_xref="dbSNP:3178482" variation 678 /gene="GPHA2" /gene_synonym="A2; GPA2; ZSIG51" /replace="c" /replace="t" /db_xref="dbSNP:3178483" ORIGIN
ccagcaggaggcacaggaaaactgcaagccgctctgttcctgggcctcggaagtgatgcctatggcgtcccctcaaaccctggtcctctatctgctggtcctggcagtcactgaagcctggggccaggaggcagtcatcccaggctgccacttgcaccccttcaatgtgacagtgcgaagtgaccgccaaggcacctgccagggctcccacgtggcacaggcctgtgtgggccactgtgagtccagcgccttcccttctcggtactctgtgctggtggccagtggttaccgacacaacatcacctccgtctctcagtgctgcaccatcagtggcctgaagaaggtcaaagtacagctgcagtgtgtggggagccggagggaggagctcgagatcttcacggccagggcctgccagtgtgacatgtgtcgcctctctcgctactagcccatcctctcccctccttcctcccctgggtcacagggcttgacgttctggtgggggaaacctgtgttcaagattcaaaaactggaaggagctccagccctgatggttacttgctatggaatttttttaaataaggggagggttgttccagctttgatcctttgtaagattttgtgactgtcacctgagaagaggggagtttctgcttcttccctgcctctgcctggcccttctaaaccaatctttcatcattttacttccctctttgcccttacccctaaataaagcaagcagttcttgaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:170589 -> Molecular function: GO:0005179 [hormone activity] evidence: IEA GeneID:170589 -> Cellular component: GO:0005576 [extracellular region] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.