GGRNA Home | Help | Advanced search

2024-03-29 11:08:08, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_080429               1794 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens aquaporin 10 (AQP10), mRNA.
ACCESSION   NM_080429
VERSION     NM_080429.2  GI:22538419
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1794)
  AUTHORS   Oberg,F., Sjohamn,J., Fischer,G., Moberg,A., Pedersen,A., Neutze,R.
            and Hedfalk,K.
  TITLE     Glycosylation increases the thermostability of human aquaporin 10
            protein
  JOURNAL   J. Biol. Chem. 286 (36), 31915-31923 (2011)
   PUBMED   21733844
  REMARK    GeneRIF: the presence of at least one glycosylated protein within
            each tetramer is sufficient to convey an enhanced structural
            stability to the remaining hAQP10 protomers of the tetramer.
REFERENCE   2  (bases 1 to 1794)
  AUTHORS   Ishii,M., Ohta,K., Katano,T., Urano,K., Watanabe,J., Miyamoto,A.,
            Inoue,K. and Yuasa,H.
  TITLE     Dual functional characteristic of human aquaporin 10 for solute
            transport
  JOURNAL   Cell. Physiol. Biochem. 27 (6), 749-756 (2011)
   PUBMED   21691092
  REMARK    GeneRIF: study unveiled the uniquely dual functional characteristic
            of hAQP10 as a carrier/channel for solute transport, providing a
            novel insight into its operation mechanism, which would help
            further elucidate its physiological role
REFERENCE   3  (bases 1 to 1794)
  AUTHORS   Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V.,
            Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
  CONSRTM   DREAM investigators
  TITLE     Variation at the NFATC2 locus increases the risk of
            thiazolidinedione-induced edema in the Diabetes REduction
            Assessment with ramipril and rosiglitazone Medication (DREAM) study
  JOURNAL   Diabetes Care 33 (10), 2250-2253 (2010)
   PUBMED   20628086
  REMARK    GeneRIF: Observational study of gene-disease association,
            gene-environment interaction, and pharmacogenomic / toxicogenomic.
            (HuGE Navigator)
REFERENCE   4  (bases 1 to 1794)
  AUTHORS   Talmud,P.J., Drenos,F., Shah,S., Shah,T., Palmen,J., Verzilli,C.,
            Gaunt,T.R., Pallas,J., Lovering,R., Li,K., Casas,J.P., Sofat,R.,
            Kumari,M., Rodriguez,S., Johnson,T., Newhouse,S.J., Dominiczak,A.,
            Samani,N.J., Caulfield,M., Sever,P., Stanton,A., Shields,D.C.,
            Padmanabhan,S., Melander,O., Hastie,C., Delles,C., Ebrahim,S.,
            Marmot,M.G., Smith,G.D., Lawlor,D.A., Munroe,P.B., Day,I.N.,
            Kivimaki,M., Whittaker,J., Humphries,S.E. and Hingorani,A.D.
  CONSRTM   ASCOT investigators; NORDIL investigators; BRIGHT Consortium
  TITLE     Gene-centric association signals for lipids and apolipoproteins
            identified via the HumanCVD BeadChip
  JOURNAL   Am. J. Hum. Genet. 85 (5), 628-642 (2009)
   PUBMED   19913121
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   5  (bases 1 to 1794)
  AUTHORS   Chapuis,J., Hot,D., Hansmannel,F., Kerdraon,O., Ferreira,S.,
            Hubans,C., Maurage,C.A., Huot,L., Bensemain,F., Laumet,G.,
            Ayral,A.M., Fievet,N., Hauw,J.J., DeKosky,S.T., Lemoine,Y.,
            Iwatsubo,T., Wavrant-Devrieze,F., Dartigues,J.F., Tzourio,C.,
            Buee,L., Pasquier,F., Berr,C., Mann,D., Lendon,C., Alperovitch,A.,
            Kamboh,M.I., Amouyel,P. and Lambert,J.C.
  TITLE     Transcriptomic and genetic studies identify IL-33 as a candidate
            gene for Alzheimer's disease
  JOURNAL   Mol. Psychiatry 14 (11), 1004-1016 (2009)
   PUBMED   19204726
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   6  (bases 1 to 1794)
  AUTHORS   Flach,C.F., Qadri,F., Bhuiyan,T.R., Alam,N.H., Jennische,E.,
            Holmgren,J. and Lonnroth,I.
  TITLE     Differential expression of intestinal membrane transporters in
            cholera patients
  JOURNAL   FEBS Lett. 581 (17), 3183-3188 (2007)
   PUBMED   17575980
REFERENCE   7  (bases 1 to 1794)
  AUTHORS   Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z.,
            Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S.,
            McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J.,
            Dunham,I., Hill,D.E. and Vidal,M.
  TITLE     hORFeome v3.1: a resource of human open reading frames representing
            over 10,000 human genes
  JOURNAL   Genomics 89 (3), 307-315 (2007)
   PUBMED   17207965
REFERENCE   8  (bases 1 to 1794)
  AUTHORS   Li,H., Kamiie,J., Morishita,Y., Yoshida,Y., Yaoita,E., Ishibashi,K.
            and Yamamoto,T.
  TITLE     Expression and localization of two isoforms of AQP10 in human small
            intestine
  JOURNAL   Biol. Cell 97 (11), 823-829 (2005)
   PUBMED   15898950
  REMARK    GeneRIF: AQP10 with an insertion of 475 nt was localized in the
            capillary endothelium in villi of the small intestine and the
            isoform without the insertion localized in the
            gastro-entero-pancrestic endocrine cells.
REFERENCE   9  (bases 1 to 1794)
  AUTHORS   Ishibashi,K., Morinaga,T., Kuwahara,M., Sasaki,S. and Imai,M.
  TITLE     Cloning and identification of a new member of water channel (AQP10)
            as an aquaglyceroporin
  JOURNAL   Biochim. Biophys. Acta 1576 (3), 335-340 (2002)
   PUBMED   12084581
  REMARK    GeneRIF: Results suggest that AQP10 represents a new member of
            aquaglyceroporins functionally as well as structurally.
REFERENCE   10 (bases 1 to 1794)
  AUTHORS   Hatakeyama,S., Yoshida,Y., Tani,T., Koyama,Y., Nihei,K.,
            Ohshiro,K., Kamiie,J.I., Yaoita,E., Suda,T., Hatakeyama,K. and
            Yamamoto,T.
  TITLE     Cloning of a new aquaporin (AQP10) abundantly expressed in duodenum
            and jejunum
  JOURNAL   Biochem. Biophys. Res. Commun. 287 (4), 814-819 (2001)
   PUBMED   11573934
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AB066105.1.
            On Aug 29, 2002 this sequence version replaced gi:17975594.
            
            Summary: This gene encodes a member of the aquaglyceroporin family
            of integral membrane proteins. Members of this family function as
            water-permeable channels in the epithelia of organs that absorb and
            excrete water. This protein was shown to function as a
            water-selective channel, and could also permeate neutral solutes
            such as glycerol and urea. [provided by RefSeq, Jul 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AB066105.1, BC074896.2 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           ERS025083, ERS025084 [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..1794
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1q21.3"
     gene            1..1794
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /note="aquaporin 10"
                     /db_xref="GeneID:89872"
                     /db_xref="HGNC:16029"
                     /db_xref="HPRD:07361"
                     /db_xref="MIM:606578"
     STS             1..1037
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /db_xref="UniSTS:481786"
     exon            1..145
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /inference="alignment:Splign:1.39.8"
     STS             4..980
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /db_xref="UniSTS:482063"
     STS             8..1353
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /db_xref="UniSTS:489981"
     misc_feature    26..28
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /note="upstream in-frame stop codon"
     CDS             41..946
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /note="small intestine aquaporin; AQP-10;
                     aquaglyceroporin-10"
                     /codon_start=1
                     /product="aquaporin-10"
                     /protein_id="NP_536354.2"
                     /db_xref="GI:22538420"
                     /db_xref="CCDS:CCDS1065.1"
                     /db_xref="GeneID:89872"
                     /db_xref="HGNC:16029"
                     /db_xref="HPRD:07361"
                     /db_xref="MIM:606578"
                     /translation="
MVFTQAPAEIMGHLRIRSLLARQCLAEFLGVFVLMLLTQGAVAQAVTSGETKGNFFTMFLAGSLAVTIAIYVGGNVSGAHLNPAFSLAMCIVGRLPWVKLPIYILVQLLSAFCASGATYVLYHDALQNYTGGNLTVTGPKETASIFATYPAPYLSLNNGFLDQVLGTGMLIVGLLAILDRRNKGVPAGLEPVVVGMLILALGLSMGANCGIPLNPARDLGPRLFTYVAGWGPEVFSAGNGWWWVPVVAPLVGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECKL
"
     misc_feature    104..829
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /note="Major intrinsic protein (MIP) superfamily. Members
                     of the MIP superfamily function as membrane channels that
                     selectively transport water, small neutral molecules, and
                     ions out of and between cells. The channel proteins share
                     a common fold: the N-terminal...; Region: MIP; cd00333"
                     /db_xref="CDD:29423"
     misc_feature    122..184
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q96PS8.2);
                     transmembrane region"
     misc_feature    197..259
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q96PS8.2);
                     transmembrane region"
     misc_feature    order(224..226,278..286,668..673,680..682,689..691)
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /note="amphipathic channel; other site"
                     /db_xref="CDD:29423"
     misc_feature    order(284..292,680..688)
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /note="Asn-Pro-Ala signature motifs; other site"
                     /db_xref="CDD:29423"
     misc_feature    284..292
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q96PS8.2);
                     Region: NPA 1"
     misc_feature    344..406
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q96PS8.2);
                     transmembrane region"
     misc_feature    509..571
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q96PS8.2);
                     transmembrane region"
     misc_feature    602..664
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q96PS8.2);
                     transmembrane region"
     misc_feature    680..688
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q96PS8.2);
                     Region: NPA 2"
     variation       61
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:368763727"
     variation       84
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6668968"
     variation       104
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:371762595"
     variation       112
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146318444"
     variation       141
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375905475"
     exon            146..272
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /inference="alignment:Splign:1.39.8"
     variation       201
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:77290607"
     variation       201
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201824170"
     variation       208
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78213238"
     variation       208
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200279756"
     variation       236
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201059654"
     variation       244
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201098812"
     variation       255
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199806224"
     exon            273..410
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /inference="alignment:Splign:1.39.8"
     variation       323
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372798902"
     variation       332
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374795337"
     variation       334
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367711654"
     variation       340
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140477648"
     variation       385
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138299081"
     variation       407
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6685323"
     variation       409
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61739738"
     exon            411..529
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /inference="alignment:Splign:1.39.8"
     variation       496
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148220488"
     variation       502
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200551947"
     exon            530..747
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /inference="alignment:Splign:1.39.8"
     variation       541
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1194610"
     variation       571
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147224722"
     variation       595
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376171472"
     variation       601
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:370543262"
     variation       687
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:193133403"
     variation       701
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372825269"
     variation       705
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200639079"
     variation       719
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377590602"
     variation       741
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370728661"
     variation       745
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:144627448"
     exon            748..1791
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /inference="alignment:Splign:1.39.8"
     variation       764
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200974498"
     variation       776
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148928654"
     variation       797..798
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:147478762"
     variation       802
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:41304552"
     variation       841
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368300859"
     variation       846
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:35368642"
     variation       876
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201240485"
     variation       879
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201101129"
     variation       915
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:141365858"
     variation       971
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370961457"
     variation       976
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:375198347"
     variation       1013
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:3892533"
     variation       1238
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:370046876"
     variation       1293
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374264242"
     variation       1313
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142224753"
     variation       1457
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:41304275"
     variation       1498
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377050233"
     variation       1592
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369480572"
     variation       1682
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183908821"
     polyA_signal    1768..1773
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /experiment="experimental evidence, no additional details
                     recorded"
     variation       1776
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:77213139"
     variation       1777
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:75110063"
     polyA_site      1791
                     /gene="AQP10"
                     /gene_synonym="AQPA_HUMAN"
                     /experiment="experimental evidence, no additional details
                     recorded"
ORIGIN      
agacagagggagcagtgaatagcaatagggtgtttccaccatggtcttcactcaggccccggctgaaatcatgggccacctccggatacgcagcctcctggcccggcagtgcctggcagagtttctgggtgtgtttgtactcatgctcctcacccaaggagctgtggcccaggctgtcaccagtggagaaaccaaaggcaacttcttcaccatgtttctggctggctctctggccgttacgatagccatctacgtgggtggtaacgtctcaggggcccacctgaatccagccttctccctggccatgtgcatcgttggacgcctcccctgggtcaagctccccatttacatcttggtgcagttgctgtctgctttctgtgcttcgggagccacctatgttctctaccatgatgccctacagaactatacaggtgggaacctgacagtgactggccccaaggagacagcctccatttttgccacctatcctgccccctatctgtccctgaacaatggcttcctggatcaggttctgggcactgggatgctgattgtggggctcttggccatcctggacagacggaacaagggagtccctgcgggtctggagcctgtggtggtggggatgctgatcctggccctcgggttatccatgggtgccaactgcgggattccactcaaccctgcccgggacctgggcccacgtctcttcacctacgtggctggctggggtcctgaagtcttcagtgctggtaatggctggtggtgggtgcctgtggtggcccctctggtgggggccaccgttggcacagccacttaccagctgttggtggctctgcaccaccctgagggcccagagccagctcaggatctggtgtctgctcaacacaaagcctcagagttggaaactcctgcctcagctcagatgctggagtgtaagctatgattaggacaaccctcacttcactcatggaccctggagccagccactgaccccgcctgggaacaacagtcattcttcctctttgttaatgtgccagaacctgggaggcttctctgtttatctgtttggcatcccttcctcctaaactaagaaggatcctggacagggagaagtggaggaggataaggtaccaggactcaggcttctcatcccctcctcccgcaaagcggttttctgaccctcagggcctctcggaatgtagttgctcgaggtaaccgctagagggtgcgcacctggatgctggatggggacggctgcgggcatctgcagggtggagggggccaccatccagtgtagggcacaaccctggggactgccctccatagcctgtcccgactgccgactcctagctctcatcgcctcggcgcctcccaccttcaccctctcggggatgcctccccaagagggtagttaggggtggggaagccgcctccacccagggggcgtggtgggggcggagggaaggagggcggcggggcacagagacagagagcaaggctgtgaaactgaggcaccgttcctagacatctcggtgctgtgtcgttcattcaaggagagttgagatacagtgaaatgagccagggcgaggagggagggtgaaggaacggagggcgggcggctccgaggagcgagagtcgggctgagggcaacctggcgccagggaaaattctggttattcaccacttctacagctctcctgccgctccctgcagaggatgctcgttttgcagagaaggcagtgttcctctattcccttcttccgaattaaaaataccccctcagagcgaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:89872 -> Molecular function: GO:0005215 [transporter activity] evidence: IEA
            GeneID:89872 -> Biological process: GO:0006833 [water transport] evidence: TAS
            GeneID:89872 -> Biological process: GO:0009636 [response to toxic substance] evidence: IDA
            GeneID:89872 -> Biological process: GO:0055085 [transmembrane transport] evidence: TAS
            GeneID:89872 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS
            GeneID:89872 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.