2024-04-24 17:16:31, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_078485 3073 bp mRNA linear PRI 09-MAY-2013 DEFINITION Homo sapiens collagen, type IX, alpha 1 (COL9A1), transcript variant 2, mRNA. ACCESSION NM_078485 VERSION NM_078485.3 GI:189181664 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 3073) AUTHORS Boudko,S.P. and Bachinger,H.P. TITLE The NC2 domain of type IX collagen determines the chain register of the triple helix JOURNAL J. Biol. Chem. 287 (53), 44536-44545 (2012) PUBMED 23132862 REMARK GeneRIF: The NC2 domain of type IX collagen determines the chain composition but also the chain register of the triple helix. REFERENCE 2 (bases 1 to 3073) AUTHORS Parsons,P., Gilbert,S.J., Vaughan-Thomas,A., Sorrell,D.A., Notman,R., Bishop,M., Hayes,A.J., Mason,D.J. and Duance,V.C. TITLE Type IX collagen interacts with fibronectin providing an important molecular bridge in articular cartilage JOURNAL J. Biol. Chem. 286 (40), 34986-34997 (2011) PUBMED 21768108 REMARK GeneRIF: Type IX collagen interacts with fibronectin providing an important molecular bridge in articular cartilage REFERENCE 3 (bases 1 to 3073) AUTHORS Liu,L.Y., Jin,C.L., Jiang,L. and Lin,C.K. TITLE [Expression of COL9A1 gene and its polymorphism in children with idiopathic congenital talipes equinovarus] JOURNAL Zhongguo Dang Dai Er Ke Za Zhi 13 (6), 478-481 (2011) PUBMED 21672422 REMARK GeneRIF: COL9A1 protein is highly expressed in patients with idiopathic congenital talipes equinovarus (ICTEV) and rs1135056, which is located in the coding region of COL9A1 gene, may be associated with the pathogenesis of ICTEV. REFERENCE 4 (bases 1 to 3073) AUTHORS Nikopoulos,K., Schrauwen,I., Simon,M., Collin,R.W., Veckeneer,M., Keymolen,K., Van Camp,G., Cremers,F.P. and van den Born,L.I. TITLE Autosomal recessive Stickler syndrome in two families is caused by mutations in the COL9A1 gene JOURNAL Invest. Ophthalmol. Vis. Sci. 52 (7), 4774-4779 (2011) PUBMED 21421862 REMARK GeneRIF: A second, novel mutation was identified in COL9A1, causing autosomal recessive Stickler syndrome together with the previously described nucleotide change in two separate families. Publication Status: Online-Only REFERENCE 5 (bases 1 to 3073) AUTHORS Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S. CONSRTM DREAM investigators TITLE Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study JOURNAL Diabetes Care 33 (10), 2250-2253 (2010) PUBMED 20628086 REMARK GeneRIF: Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) REFERENCE 6 (bases 1 to 3073) AUTHORS Muragaki,Y., Kimura,T., Ninomiya,Y. and Olsen,B.R. TITLE The complete primary structure of two distinct forms of human alpha 1 (IX) collagen chains JOURNAL Eur. J. Biochem. 192 (3), 703-708 (1990) PUBMED 2209617 REFERENCE 7 (bases 1 to 3073) AUTHORS Muragaki,Y., Nishimura,I., Henney,A., Ninomiya,Y. and Olsen,B.R. TITLE The alpha 1 (IX) collagen gene gives rise to two different transcripts in both mouse embryonic and human fetal RNA JOURNAL Proc. Natl. Acad. Sci. U.S.A. 87 (7), 2400-2404 (1990) PUBMED 1690886 REFERENCE 8 (bases 1 to 3073) AUTHORS Kimura,T., Mattei,M.G., Stevens,J.W., Goldring,M.B., Ninomiya,Y. and Olsen,B.R. TITLE Molecular cloning of rat and human type IX collagen cDNA and localization of the alpha 1(IX) gene on the human chromosome 6 JOURNAL Eur. J. Biochem. 179 (1), 71-78 (1989) PUBMED 2465149 REFERENCE 9 (bases 1 to 3073) AUTHORS McCormick,D., van der Rest,M., Goodship,J., Lozano,G., Ninomiya,Y. and Olsen,B.R. TITLE Structure of the glycosaminoglycan domain in the type IX collagen-proteoglycan JOURNAL Proc. Natl. Acad. Sci. U.S.A. 84 (12), 4044-4048 (1987) PUBMED 3473493 REFERENCE 10 (bases 1 to 3073) AUTHORS Richardson,G.P., Russell,I.J., Duance,V.C. and Bailey,A.J. TITLE Polypeptide composition of the mammalian tectorial membrane JOURNAL Hear. Res. 25 (1), 45-60 (1987) PUBMED 3542919 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA392556.1, BC063646.1, X54412.1, BF196880.1 and AW021120.1. On May 30, 2008 this sequence version replaced gi:73486663. Summary: This gene encodes one of the three alpha chains of type IX collagen, which is a minor (5-20%) collagen component of hyaline cartilage. Type IX collagen is usually found in tissues containing type II collagen, a fibrillar collagen. Studies in knockout mice have shown that synthesis of the alpha 1 chain is essential for assembly of type IX collagen molecules, a heterotrimeric molecule, and that lack of type IX collagen is associated with early onset osteoarthritis. Mutations in this gene are associated with osteoarthritis in humans, with multiple epiphyseal dysplasia, 6, a form of chondrodysplasia, and with Stickler syndrome, a disease characterized by ophthalmic, orofacial, articular, and auditory defects. Two transcript variants that encode different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]. Transcript Variant: This variant (2) differs in the 5' UTR and lacks several exons in the 5' coding region, compared to variant 1. These differences cause translation initiation at a unique AUG and an isoform (2, also known as the short form) with a shorter N-terminus, compared to isoform 1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC063646.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-26 CA392556.1 1-26 27-1154 BC063646.1 1-1128 1155-1895 X54412.1 1859-2599 1896-2434 BC063646.1 1870-2408 2435-2947 BF196880.1 27-539 c 2948-3073 AW021120.1 108-233 FEATURES Location/Qualifiers source 1..3073 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="6" /map="6q13" gene 1..3073 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /note="collagen, type IX, alpha 1" /db_xref="GeneID:1297" /db_xref="HGNC:2217" /db_xref="MIM:120210" exon 1..228 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" misc_feature 139..141 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /note="upstream in-frame stop codon" CDS 157..2193 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /note="isoform 2 precursor is encoded by transcript variant 2; cartilage-specific short collagen; collagen IX, alpha-1 polypeptide; collagen alpha-1(IX) chain; alpha-1(IX) collagen chain" /codon_start=1 /product="collagen alpha-1(IX) chain isoform 2 precursor" /protein_id="NP_511040.2" /db_xref="GI:73486664" /db_xref="CCDS:CCDS47447.1" /db_xref="GeneID:1297" /db_xref="HGNC:2217" /db_xref="MIM:120210" /translation="
MAWTARDRGALGLLLLGLCLCAAQRGPPGEQGPPGPPGPPGVPGIDGIDGDRGPKGPPGPPGPAGEPGKPGAPGKPGTPGADGLTGPDGSPGSIGSKGQKGEPGVPGSRGFPGRGIPGPPGPPGTAGLPGELGRVGPVGDPGRRGPPGPPGPPGPRGTIGFHDGDPLCPNACPPGRSGYPGLPGMRGHKGAKGEIGEPGRQGHKGEEGDQGELGEVGAQGPPGAQGLRGITGIVGDKGEKGARGLDGEPGPQGLPGAPGDQGQRGPPGEAGPKGDRGAEGARGIPGLPGPKGDTGLPGVDGRDGIPGMPGTKGEPGKPGPPGDAGLQGLPGVPGIPGAKGVAGEKGSTGAPGKPGQMGNSGKPGQQGPPGEVGPRGPQGLPGSRGELGPVGSPGLPGKLGSLGSPGLPGLPGPPGLPGMKGDRGVVGEPGPKGEQGASGEEGEAGERGELGDIGLPGPKGSAGNPGEPGLRGPEGSRGLPGVEGPRGPPGPRGVQGEQGATGLPGVQGPPGRAPTDQHIKQVCMRVIQEHFAEMAASLKRPDSGATGLPGRPGPPGPPGPPGENGFPGQMGIRGLPGIKGPPGALGLRGPKGDLGEKGERGPPGRGPNGLPGAIGLPGDPGPASYGRNGRDGERGPPGVAGIPGVPGPPGPPGLPGFCEPASCTMQAGQRAFNKGPDP
" sig_peptide 157..225 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="COORDINATES: ab initio prediction:SignalP:4.0" mat_peptide 226..2190 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /product="collagen alpha-1(IX) chain isoform 2" exon 229..303 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" exon 304..339 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" exon 340..402 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" exon 403..456 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" exon 457..492 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" exon 493..516 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" variation 498 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:607156" exon 517..570 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" exon 571..624 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" variation 609 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /replace="c" /replace="t" /db_xref="dbSNP:1135052" exon 625..657 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" exon 658..714 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" exon 715..768 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" exon 769..822 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" exon 823..876 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" variation 853 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /replace="a" /replace="t" /db_xref="dbSNP:1135054" exon 877..930 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" exon 931..984 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" exon 985..1038 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" exon 1039..1092 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" exon 1093..1146 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" variation 1137 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /replace="g" /replace="t" /db_xref="dbSNP:1135055" exon 1147..1191 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" exon 1192..1245 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" exon 1246..1299 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" variation 1289 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /replace="a" /replace="g" /db_xref="dbSNP:1135056" exon 1300..1353 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" exon 1354..1425 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" exon 1426..1461 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" exon 1462..1506 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" variation 1477 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /replace="a" /replace="g" /db_xref="dbSNP:35470562" exon 1507..1539 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" exon 1540..1686 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" exon 1687..1741 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" variation 1698 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /replace="a" /replace="g" /db_xref="dbSNP:2072650" exon 1742..1930 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" STS 1769..1928 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /standard_name="STS-X54412" /db_xref="UniSTS:76405" variation 1897 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /replace="a" /replace="c" /db_xref="dbSNP:34119578" exon 1931..2008 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" variation 1989 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /replace="a" /replace="t" /db_xref="dbSNP:1135057" exon 2009..3050 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /inference="alignment:Splign:1.39.8" variation 2034 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /replace="c" /replace="g" /db_xref="dbSNP:1056920" variation 2036 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /replace="a" /replace="g" /db_xref="dbSNP:1056921" variation 2071 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1056923" variation 2422 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /replace="c" /replace="t" /db_xref="dbSNP:2459555" variation 2435..2436 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /replace="" /replace="a" /db_xref="dbSNP:3215859" variation 2459 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /replace="c" /replace="t" /db_xref="dbSNP:1064250" polyA_signal 2536..2541 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" polyA_site 2567 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" STS 2759..2930 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" /standard_name="RH46227" /db_xref="UniSTS:30088" polyA_signal 2946..2951 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" polyA_site 2964 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" polyA_signal 3032..3037 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" polyA_site 3050 /gene="COL9A1" /gene_synonym="DJ149L1.1.2; EDM6; MED; STL4" ORIGIN
gcgcgcctcccgggcctggacgctttggcaaccgctactcccgggggtgctttttctgcagggacgaagtgccacctatgctagtggcgggtctggaagcctagaggggaaccaggctgcagagccgggccaagggattagcggcgggcggcgggcatggcctggactgcgcgggaccgcggggccctggggctgctgctgttggggctctgcttgtgcgcggctcaaagaggtcccccgggtgagcagggtcctcccgggcctccgggcccccctggagttccaggcatcgatggcatcgacggtgaccgaggtcctaagggccccccgggccccccgggtcctgcaggtgaaccgggaaagccaggagctccaggcaagcctggcacacctggcgctgatggattaacaggacctgatggatcccctggctccattgggtcaaagggacaaaaaggagaacctggtgtgcctggatcgcgtggatttccaggccgtggtattcctggaccccctggtcctcctgggacagcaggactccctggagagcttggccgtgtaggacctgttggtgaccctgggagaagaggaccacctggcccccctggccccccaggacccagaggaacaattggctttcatgatggagatccattgtgtcccaatgcctgtccaccaggtcgctcaggatatccaggcctaccaggcatgaggggtcataaaggggctaaaggagaaattggtgaaccaggaagacaaggacacaagggtgaagaaggtgaccagggagaactcggagaagttggagctcaaggacctccaggagcccagggtttgcgaggcatcaccggcatagttggggacaaaggggaaaaaggtgctcggggcttagatggtgaacctgggcctcagggtcttcctggtgcacctggtgatcaaggacagcgaggacctccaggagaagcaggtcccaaaggagatagaggggctgaaggtgctagaggaattcctggtctccctgggcccaaaggagacacgggtttgccaggtgtggatggccgtgatgggatccctggaatgcctggaacaaagggtgaaccaggaaaacctgggcctcctggtgatgcaggattgcaggggttaccaggtgtacctggaattcctggtgcaaagggtgttgctggtgaaaagggtagcacaggtgctccagggaagcctggtcagatgggaaattcaggcaaaccgggccaacaggggcctccaggagaggtgggaccccgaggaccccaggggcttcctggcagtagaggagaattaggaccagtgggatccccaggcctaccaggtaaactgggttctctgggtagccctggcctccctggcttgcctgggccccctggacttcctggaatgaaaggtgacaggggtgtagtcggtgaaccgggtccaaagggtgaacagggtgcctctggtgaagaaggtgaagcaggagaaaggggggaacttggagatataggattacctggcccaaagggatctgcaggtaatcctggggaacctggcttgagagggcctgagggaagtcgggggcttcctggagtggaaggaccaagaggaccacctggaccccggggtgtgcagggagaacagggtgccaccggcctgcctggtgtccagggccctccgggtagagcaccgacagatcagcacattaagcaggtttgcatgagagtcatacaagaacattttgctgagatggctgccagtcttaagcgtccagactcaggtgccactgggcttcctggaaggcctggccctcctggtccccccggccctcctggagagaatggtttcccaggccagatgggaattcgtggccttccgggcattaaggggccccctggtgctcttggtttgaggggacctaaaggtgacttgggagaaaagggggagcgtggccctccaggaagaggtcccaacggtttgcctggagctataggtctcccaggtgacccaggccctgccagctatggcagaaatggccgagacggtgagcgaggccccccaggggtggcaggaattcctggagtgcctggacccccgggacctcctgggcttcccggtttctgtgagccagcctcctgcaccatgcaggctggtcagcgagcatttaacaaagggcctgacccttgaaaggcttactgctgcatggctgtctgcatgaaccacgcctggtgaaggagcctgggtgagaaacaccatccaaagctggggcaaagatgattaccttcagcatgattacaatgtattaccttcagtatgattacagaagtcctacttgacaatcacatatagaagaacggtgctattcagtaagttctctttcctttcccttggagggaagacagcagagtcatcagttaaaaaaaaaaaaagaaaaccaaacacctcccttgaataaatttatactcctgttcccaggatcttgagctttagtgtgctatacctatgtgtcttatcgtgggccactgtgccaataaacaaaaacaactgtttggtttacctcagttgcagtagttattttcatttagaagttgttctcagattattgtttcagttatatagaggattactagactagttatgaagaaaccccactacattcaatggaattggtgcttaaaatctcatcgatgtgctgtctctggagtgataagaaagggctacatctcccgaaatgatttctttacgtcatgtattggtttccttcttcaccttgaacttttgttgaactgtatgtactttaccccaaacctgttaatattttgagcgcttctatgtgaaagcaaagaaataattttaatactctggcattcataaattttattgatgagattatttattttaaaggtttgaggtaacatctctggttgtaccaaagaagaaataaatatggtttcttaatctcttgcatgttttcttataaataatcatgttcaatgaaaagaagttactgagcttatttagatacattaaacattacttaactaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:1297 -> Molecular function: GO:0030020 [extracellular matrix structural constituent conferring tensile strength] evidence: IC GeneID:1297 -> Molecular function: GO:0046872 [metal ion binding] evidence: IEA GeneID:1297 -> Biological process: GO:0001894 [tissue homeostasis] evidence: IEA GeneID:1297 -> Biological process: GO:0003417 [growth plate cartilage development] evidence: IEA GeneID:1297 -> Biological process: GO:0007411 [axon guidance] evidence: TAS GeneID:1297 -> Biological process: GO:0009887 [organ morphogenesis] evidence: TAS GeneID:1297 -> Biological process: GO:0022617 [extracellular matrix disassembly] evidence: TAS GeneID:1297 -> Biological process: GO:0030198 [extracellular matrix organization] evidence: TAS GeneID:1297 -> Biological process: GO:0030574 [collagen catabolic process] evidence: TAS GeneID:1297 -> Cellular component: GO:0005576 [extracellular region] evidence: TAS GeneID:1297 -> Cellular component: GO:0005594 [collagen type IX] evidence: IDA GeneID:1297 -> Cellular component: GO:0005594 [collagen type IX] evidence: TAS GeneID:1297 -> Cellular component: GO:0005788 [endoplasmic reticulum lumen] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.