Home |
Help |
Advanced search
2024-04-20 23:42:14, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_033340 2451 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens caspase 7, apoptosis-related cysteine peptidase
(CASP7), transcript variant b, mRNA.
ACCESSION NM_033340
VERSION NM_033340.3 GI:388596696
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2451)
AUTHORS Park,C., Han,S., Lee,K.M., Choi,J.Y., Song,N., Jeon,S., Park,S.K.,
Ahn,H.S., Shin,H.Y., Kang,H.J., Koo,H.H., Seo,J.J., Choi,J.E. and
Kang,D.
TITLE Association between CASP7 and CASP14 genetic polymorphisms and the
risk of childhood leukemia
JOURNAL Hum. Immunol. 73 (7), 736-739 (2012)
PUBMED 22548721
REMARK GeneRIF: genetic polynorphism is associated with the risk of
childhood leukemia
REFERENCE 2 (bases 1 to 2451)
AUTHORS Nagano,T., Hashimoto,T., Nakashima,A., Kikkawa,U. and Kamada,S.
TITLE X-linked inhibitor of apoptosis protein mediates neddylation by
itself but does not function as a NEDD8-E3 ligase for caspase-7
JOURNAL FEBS Lett. 586 (11), 1612-1616 (2012)
PUBMED 22584050
REMARK GeneRIF: XIAP does not function as a NEDD8-E3 ligase for caspase-7
in vivo
REFERENCE 3 (bases 1 to 2451)
AUTHORS Jin,Y., Birlea,S.A., Fain,P.R., Ferrara,T.M., Ben,S.,
Riccardi,S.L., Cole,J.B., Gowan,K., Holland,P.J., Bennett,D.C.,
Luiten,R.M., Wolkerstorfer,A., van der Veen,J.P., Hartmann,A.,
Eichner,S., Schuler,G., van Geel,N., Lambert,J., Kemp,E.H.,
Gawkrodger,D.J., Weetman,A.P., Taieb,A., Jouary,T., Ezzedine,K.,
Wallace,M.R., McCormack,W.T., Picardo,M., Leone,G., Overbeck,A.,
Silverberg,N.B. and Spritz,R.A.
TITLE Genome-wide association analyses identify 13 new susceptibility
loci for generalized vitiligo
JOURNAL Nat. Genet. 44 (6), 676-680 (2012)
PUBMED 22561518
REMARK Publication Status: Online-Only
REFERENCE 4 (bases 1 to 2451)
AUTHORS Boucher,D., Blais,V. and Denault,J.B.
TITLE Caspase-7 uses an exosite to promote poly(ADP ribose) polymerase 1
proteolysis
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 109 (15), 5669-5674 (2012)
PUBMED 22451931
REMARK GeneRIF: Cellular expression of caspase-7 lacking the critical
lysine residues resulted in less-efficient PARP and p23 cleavage
compared with cells expressing the wild-type peptidase.
REFERENCE 5 (bases 1 to 2451)
AUTHORS Riedl,S.J., Fuentes-Prior,P., Renatus,M., Kairies,N., Krapp,S.,
Huber,R., Salvesen,G.S. and Bode,W.
TITLE Structural basis for the activation of human procaspase-7
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 98 (26), 14790-14795 (2001)
PUBMED 11752425
REFERENCE 6 (bases 1 to 2451)
AUTHORS Tiso,N., Pallavicini,A., Muraro,T., Zimbello,R., Apolloni,E.,
Valle,G., Lanfranchi,G. and Danieli,G.A.
TITLE Chromosomal localization of the human genes, CPP32, Mch2, Mch3, and
Ich-1, involved in cellular apoptosis
JOURNAL Biochem. Biophys. Res. Commun. 225 (3), 983-989 (1996)
PUBMED 8780721
REFERENCE 7 (bases 1 to 2451)
AUTHORS Lippke,J.A., Gu,Y., Sarnecki,C., Caron,P.R. and Su,M.S.
TITLE Identification and characterization of CPP32/Mch2 homolog 1, a
novel cysteine protease similar to CPP32
JOURNAL J. Biol. Chem. 271 (4), 1825-1828 (1996)
PUBMED 8567622
REFERENCE 8 (bases 1 to 2451)
AUTHORS Fernandes-Alnemri,T., Takahashi,A., Armstrong,R., Krebs,J.,
Fritz,L., Tomaselli,K.J., Wang,L., Yu,Z., Croce,C.M., Salveson,G.
et al.
TITLE Mch3, a novel human apoptotic cysteine protease highly related to
CPP32
JOURNAL Cancer Res. 55 (24), 6045-6052 (1995)
PUBMED 8521391
REFERENCE 9 (bases 1 to 2451)
AUTHORS Fernandes-Alnemri,T., Litwack,G. and Alnemri,E.S.
TITLE CPP32, a novel human apoptotic protein with homology to
Caenorhabditis elegans cell death protein Ced-3 and mammalian
interleukin-1 beta-converting enzyme
JOURNAL J. Biol. Chem. 269 (49), 30761-30764 (1994)
PUBMED 7983002
REFERENCE 10 (bases 1 to 2451)
AUTHORS Olson,R.E., Morello,J.A. and Kieff,E.D.
TITLE Antibiotic treatment of oral anaerobic infections
JOURNAL J Oral Surg 33 (8), 619-621 (1975)
PUBMED 1056466
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DC364916.1, U37449.1,
BC015799.1, BM976488.1 and BQ006259.1.
On May 30, 2012 this sequence version replaced gi:73623014.
Summary: This gene encodes a member of the cysteine-aspartic acid
protease (caspase) family. Sequential activation of caspases plays
a central role in the execution-phase of cell apoptosis. Caspases
exist as inactive proenzymes which undergo proteolytic processing
at conserved aspartic residues to produce two subunits, large and
small, that dimerize to form the active enzyme. The precursor of
the encoded protein is cleaved by caspase 3 and 10, is activated
upon cell death stimuli and induces apoptosis. Alternatively
spliced transcript variants encoding multiple isoforms have been
observed for this gene. [provided by RefSeq, May 2012].
Transcript Variant: This variant (b, also known as beta) has
multiple differences in the 5' UTR and coding region, and initiates
translation at a downstream in-frame start codon, compared to
variant d. The encoded isoform (beta) is shorter and has a distinct
C-terminus, compared to isoform delta.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: U37449.1 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
ERS025081, ERS025083 [ECO:0000350]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-42 DC364916.1 1-42
43-1249 U37449.1 1-1207
1250-1875 BC015799.1 1174-1799
1876-2431 BM976488.1 17-572 c
2432-2451 BQ006259.1 1-20 c
FEATURES Location/Qualifiers
source 1..2451
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="10"
/map="10q25"
gene 1..2451
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/note="caspase 7, apoptosis-related cysteine peptidase"
/db_xref="GeneID:840"
/db_xref="HGNC:1508"
/db_xref="HPRD:03457"
/db_xref="MIM:601761"
exon 1..188
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/inference="alignment:Splign:1.39.8"
variation 19
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:147508769"
variation 22
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="g"
/db_xref="dbSNP:377582080"
variation 184
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="g"
/db_xref="dbSNP:184916498"
CDS 189..950
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/EC_number="3.4.22.60"
/note="isoform beta is encoded by transcript variant b;
caspase 7, apoptosis-related cysteine protease; ICE-like
apoptotic protease 3; apoptotic protease MCH-3"
/codon_start=1
/product="caspase-7 isoform beta"
/protein_id="NP_203126.1"
/db_xref="GI:15718702"
/db_xref="CCDS:CCDS7582.1"
/db_xref="GeneID:840"
/db_xref="HGNC:1508"
/db_xref="HPRD:03457"
/db_xref="MIM:601761"
/translation="
MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENMESCSVTQAGVQRRDLGRLQPPPPRLAEGPSLMMASRPTRGPSMTQMLILDTRSQWKLTSSSPIPRFQAITRGGAQEEAPGLCKPSAPSWRSTEKTWKSCRSSPG
"
misc_feature 255..257
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/experiment="experimental evidence, no additional details
recorded"
/note="proteolytic cleavage site; modified site"
/db_xref="HPRD:00476"
misc_feature 366..>680
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/note="Caspase, interleukin-1 beta converting enzyme (ICE)
homologues; Cysteine-dependent aspartate-directed
proteases that mediate programmed cell death (apoptosis).
Caspases are synthesized as inactive zymogens and
activated by proteolysis of the peptide...; Region: CASc;
cl00042"
/db_xref="CDD:206797"
misc_feature 618..620
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/note="active site"
/db_xref="CDD:28914"
exon 189..298
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/inference="alignment:Splign:1.39.8"
variation 200
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="g"
/replace="t"
/db_xref="dbSNP:11555408"
variation 223
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:147218371"
variation 232
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="t"
/db_xref="dbSNP:367975864"
variation 270
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="t"
/db_xref="dbSNP:372133111"
variation 271
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:115389257"
variation 289
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="c"
/db_xref="dbSNP:372587822"
exon 299..435
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/inference="alignment:Splign:1.39.8"
variation 325
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:148675407"
variation 348
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="t"
/db_xref="dbSNP:112348087"
variation 356
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="t"
/db_xref="dbSNP:141263741"
variation 389
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:150759529"
exon 436..564
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/inference="alignment:Splign:1.39.8"
variation 444
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:115183028"
variation 452
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="t"
/db_xref="dbSNP:181777209"
variation 470
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="t"
/db_xref="dbSNP:199874997"
variation 476
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:114786731"
variation 482
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="g"
/db_xref="dbSNP:143659216"
variation 492
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="t"
/db_xref="dbSNP:202060178"
variation 493
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:146796754"
variation 497
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="t"
/db_xref="dbSNP:2229998"
variation 524
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="t"
/db_xref="dbSNP:144555540"
variation 551
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="g"
/replace="t"
/db_xref="dbSNP:368309877"
variation 554
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:115421189"
variation 558
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace=""
/replace="a"
/db_xref="dbSNP:72431166"
exon 565..632
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/inference="alignment:Splign:1.39.8"
variation 589
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="g"
/db_xref="dbSNP:372396520"
variation 611
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="g"
/db_xref="dbSNP:374718188"
exon 633..706
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/inference="alignment:Splign:1.39.8"
variation 669
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="t"
/db_xref="dbSNP:185649982"
variation 673
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:117527259"
exon 707..836
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/inference="alignment:Splign:1.39.8"
variation 713
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="t"
/db_xref="dbSNP:373690332"
variation 714
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:376348175"
variation 722
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:187106799"
variation 742
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:370774542"
variation 750
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="t"
/db_xref="dbSNP:375409071"
variation 751
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:146952079"
variation 758
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:367682197"
variation 783
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:370400085"
variation 822
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:116560793"
variation 828
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="t"
/db_xref="dbSNP:200665202"
variation 834
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="t"
/db_xref="dbSNP:137956734"
exon 837..2435
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/inference="alignment:Splign:1.39.8"
variation 847
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:1127684"
variation 854
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="c"
/db_xref="dbSNP:200326742"
variation 865
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="c"
/db_xref="dbSNP:112264603"
variation 895
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="t"
/db_xref="dbSNP:191429899"
variation 919
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="g"
/db_xref="dbSNP:2227310"
variation 934
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:2227309"
variation 944
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:116437863"
variation 954
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="c"
/db_xref="dbSNP:61755278"
variation 982
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:373028643"
variation 994
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:377322540"
variation 1002
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:373624501"
variation 1021..1022
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace=""
/replace="c"
/db_xref="dbSNP:35322299"
variation 1021
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="t"
/db_xref="dbSNP:61755279"
variation 1061
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="c"
/db_xref="dbSNP:78202169"
variation 1063
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:61757658"
variation 1100
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="t"
/db_xref="dbSNP:143800552"
variation 1124
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace=""
/replace="t"
/db_xref="dbSNP:372361034"
variation 1137
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="t"
/db_xref="dbSNP:76579192"
variation 1181
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:112631326"
variation 1251
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:148146424"
variation 1356
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="t"
/db_xref="dbSNP:4353229"
variation 1397
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="t"
/db_xref="dbSNP:1127685"
variation 1406
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="t"
/db_xref="dbSNP:1127686"
variation 1417
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="g"
/replace="t"
/db_xref="dbSNP:10787498"
variation 1422
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="t"
/db_xref="dbSNP:183912507"
variation 1439
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="t"
/db_xref="dbSNP:77191867"
variation 1534
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:188652831"
variation 1628
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:141018894"
variation 1754
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:79838074"
variation 1827
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:12247479"
variation 1832
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:181350515"
variation 1840
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:116185385"
variation 1876
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:1127687"
STS 1926..2023
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/standard_name="D10S1306E"
/db_xref="UniSTS:151338"
STS 1953..2188
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/standard_name="RH18047"
/db_xref="UniSTS:8837"
variation 1957
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:12247588"
variation 2066
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:150326299"
variation 2190
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="g"
/replace="t"
/db_xref="dbSNP:186832916"
variation 2232
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="c"
/replace="t"
/db_xref="dbSNP:137932518"
STS 2274..2423
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/standard_name="SHGC-33054"
/db_xref="UniSTS:60686"
variation 2376
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
/replace="a"
/replace="g"
/db_xref="dbSNP:190021522"
polyA_signal 2404..2409
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
polyA_site 2431
/gene="CASP7"
/gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
ORIGIN
aacaaatatttcccgaaagatccaggagcagcatctccaccagcaagctgggctgctgggtgggtacttccttcaaagctgagggagcgtcctacgcccacgcgcgcaggagggcgccccccgcaaagcaacgtctaggagaccacagtggatgccacagcgggcccgaagcggatcagccttgtgggatggcagatgatcagggctgtattgaagagcagggggttgaggattcagcaaatgaagattcagtggatgctaagccagaccggtcctcgtttgtaccgtccctcttcagtaagaagaagaaaaatgtcaccatgcgatccatcaagaccacccgggaccgagtgcctacatatcagtacaacatgaattttgaaaagctgggcaaatgcatcataataaacaacaagaactttgataaagtgacaggtatgggcgttcgaaacggaacagacaaagatgccgaggcgctcttcaagtgcttccgaagcctgggttttgacgtgattgtctataatgactgctcttgtgccaagatgcaagatctgcttaaaaaagcttctgaagaggaccatacaaatgccgcctgcttcgcctgcatcctcttaagccatggagaagaaaatatggaatcttgctctgtcacccaggctggagtgcagcggcgtgatctcggaagactgcaacctccacctcccaggcttgccgagggaccgagcttgatgatggcatccaggccgactcggggcccatcaatgacacagatgctaatcctcgatacaagatcccagtggaagctgacttcctcttcgcctattccacggttccaggctattactcgtggaggagcccaggaagaggctcctggtttgtgcaagccctctgctccatcctggaggagcacggaaaagacctggaaatcatgcagatcctcaccagggtgaatgacagagttgccaggcactttgagtctcagtctgatgacccacacttccatgagaagaagcagatcccctgtgtggtctccatgctcaccaaggaactctacttcagtcaatagccatatcaggggtacattctagctgagaagcaatgggtcactcattaatgaatcacatttttttatgctcttgaaatattcagaaattctccaggattttaatttcaggaaaatgtattgattcaacagggaagaaactttctggtgctgtcttttgttctctgaattttcagagactttttttataatgttattcatttggtgactgtgtaactttctcttaagattaattttctctttgtatgtctgttaccttgttaatagacttaatacatgcaacagaagtgacttctggagaaagctcatggctgtgtccactgcaattggtggtaacagtggtagagtcatgtttgcacttggcaaaaagaatcccaatgtttgacaaaacacagccaaggggatatttactgctctttattgcagaatgtgggtattgagtgtgatttgaatgatttttcattggcttagggcagattttcatgcaaaagttctcatatgagttagaggagaaaaagcttaatgattctgatatgtatccatcaggatccagtctggaaaacagaaaccattctaggtgtttcaacagagggagtttaatacaggaaattgacttacatagatgataaaagagaagccaaacagcaagaagctgttaccacacccagggctatgaggataatgggaagaggtttggtttcctgtgtccagtagtgggatcatccagaggagctggaaccatggtgggggctgcctagtgggagttaggaccaccaatggattgtggaaaatggagccatgacaagaacaaagccactgactgagatggagtgagctgagacagataagagaataccttggtctcacctatcctgccctcacatcttccaccagcaccttactgcccaggcctatctggaagccacctcaccaaggaccttggaagagcaagggacagtgaggcaggagaagaacaagaaatggatgtaagcctggcccataatgtgaacataagtaatcactaatgctcaacaatttatccattcaatcatttattcattgggttgtcagatagtctatgtatgtgtaaaacaatctgttttggctttatgtgcaaaatctgttatagctttaaaatatatctggaactttttagattattccaagccttattttgagtaaatatttgttacttttagttctataagtgaggaagagtttatggcaaagatttttggcactttgttttcaagatggtgttatcttttgaattcttgataaatgactgtttttttctgcctaatagtaactggttaaaaaacaaatgttcatatttattgattaaaaatgtggttgcttaattcctaaccagaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:840 -> Molecular function: GO:0004190 [aspartic-type endopeptidase activity] evidence: IEA
GeneID:840 -> Molecular function: GO:0004197 [cysteine-type endopeptidase activity] evidence: TAS
GeneID:840 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:840 -> Molecular function: GO:0008234 [cysteine-type peptidase activity] evidence: TAS
GeneID:840 -> Biological process: GO:0001836 [release of cytochrome c from mitochondria] evidence: IEA
GeneID:840 -> Biological process: GO:0006508 [proteolysis] evidence: IDA
GeneID:840 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:840 -> Biological process: GO:0006917 [induction of apoptosis] evidence: IEA
GeneID:840 -> Biological process: GO:0006921 [cellular component disassembly involved in execution phase of apoptosis] evidence: TAS
GeneID:840 -> Biological process: GO:0007507 [heart development] evidence: IEA
GeneID:840 -> Biological process: GO:0008635 [activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c] evidence: TAS
GeneID:840 -> Biological process: GO:0009411 [response to UV] evidence: IEA
GeneID:840 -> Biological process: GO:0016485 [protein processing] evidence: IEA
GeneID:840 -> Biological process: GO:0043525 [positive regulation of neuron apoptotic process] evidence: IEA
GeneID:840 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: TAS
GeneID:840 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:840 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
GeneID:840 -> Cellular component: GO:0005737 [cytoplasm] evidence: TAS
GeneID:840 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_203126 -> EC 3.4.22.60
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.