GGRNA Home | Help | Advanced search

2024-03-29 21:49:16, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_033338               2714 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens caspase 7, apoptosis-related cysteine peptidase
            (CASP7), transcript variant d, mRNA.
ACCESSION   NM_033338
VERSION     NM_033338.5  GI:388596693
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2714)
  AUTHORS   Park,C., Han,S., Lee,K.M., Choi,J.Y., Song,N., Jeon,S., Park,S.K.,
            Ahn,H.S., Shin,H.Y., Kang,H.J., Koo,H.H., Seo,J.J., Choi,J.E. and
            Kang,D.
  TITLE     Association between CASP7 and CASP14 genetic polymorphisms and the
            risk of childhood leukemia
  JOURNAL   Hum. Immunol. 73 (7), 736-739 (2012)
   PUBMED   22548721
  REMARK    GeneRIF: genetic polynorphism is associated with the risk of
            childhood leukemia
REFERENCE   2  (bases 1 to 2714)
  AUTHORS   Nagano,T., Hashimoto,T., Nakashima,A., Kikkawa,U. and Kamada,S.
  TITLE     X-linked inhibitor of apoptosis protein mediates neddylation by
            itself but does not function as a NEDD8-E3 ligase for caspase-7
  JOURNAL   FEBS Lett. 586 (11), 1612-1616 (2012)
   PUBMED   22584050
  REMARK    GeneRIF: XIAP does not function as a NEDD8-E3 ligase for caspase-7
            in vivo
REFERENCE   3  (bases 1 to 2714)
  AUTHORS   Jin,Y., Birlea,S.A., Fain,P.R., Ferrara,T.M., Ben,S.,
            Riccardi,S.L., Cole,J.B., Gowan,K., Holland,P.J., Bennett,D.C.,
            Luiten,R.M., Wolkerstorfer,A., van der Veen,J.P., Hartmann,A.,
            Eichner,S., Schuler,G., van Geel,N., Lambert,J., Kemp,E.H.,
            Gawkrodger,D.J., Weetman,A.P., Taieb,A., Jouary,T., Ezzedine,K.,
            Wallace,M.R., McCormack,W.T., Picardo,M., Leone,G., Overbeck,A.,
            Silverberg,N.B. and Spritz,R.A.
  TITLE     Genome-wide association analyses identify 13 new susceptibility
            loci for generalized vitiligo
  JOURNAL   Nat. Genet. 44 (6), 676-680 (2012)
   PUBMED   22561518
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 2714)
  AUTHORS   Boucher,D., Blais,V. and Denault,J.B.
  TITLE     Caspase-7 uses an exosite to promote poly(ADP ribose) polymerase 1
            proteolysis
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 109 (15), 5669-5674 (2012)
   PUBMED   22451931
  REMARK    GeneRIF: Cellular expression of caspase-7 lacking the critical
            lysine residues resulted in less-efficient PARP and p23 cleavage
            compared with cells expressing the wild-type peptidase.
REFERENCE   5  (bases 1 to 2714)
  AUTHORS   Riedl,S.J., Fuentes-Prior,P., Renatus,M., Kairies,N., Krapp,S.,
            Huber,R., Salvesen,G.S. and Bode,W.
  TITLE     Structural basis for the activation of human procaspase-7
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 98 (26), 14790-14795 (2001)
   PUBMED   11752425
REFERENCE   6  (bases 1 to 2714)
  AUTHORS   Tiso,N., Pallavicini,A., Muraro,T., Zimbello,R., Apolloni,E.,
            Valle,G., Lanfranchi,G. and Danieli,G.A.
  TITLE     Chromosomal localization of the human genes, CPP32, Mch2, Mch3, and
            Ich-1, involved in cellular apoptosis
  JOURNAL   Biochem. Biophys. Res. Commun. 225 (3), 983-989 (1996)
   PUBMED   8780721
REFERENCE   7  (bases 1 to 2714)
  AUTHORS   Lippke,J.A., Gu,Y., Sarnecki,C., Caron,P.R. and Su,M.S.
  TITLE     Identification and characterization of CPP32/Mch2 homolog 1, a
            novel cysteine protease similar to CPP32
  JOURNAL   J. Biol. Chem. 271 (4), 1825-1828 (1996)
   PUBMED   8567622
REFERENCE   8  (bases 1 to 2714)
  AUTHORS   Fernandes-Alnemri,T., Takahashi,A., Armstrong,R., Krebs,J.,
            Fritz,L., Tomaselli,K.J., Wang,L., Yu,Z., Croce,C.M., Salveson,G.
            et al.
  TITLE     Mch3, a novel human apoptotic cysteine protease highly related to
            CPP32
  JOURNAL   Cancer Res. 55 (24), 6045-6052 (1995)
   PUBMED   8521391
REFERENCE   9  (bases 1 to 2714)
  AUTHORS   Fernandes-Alnemri,T., Litwack,G. and Alnemri,E.S.
  TITLE     CPP32, a novel human apoptotic protein with homology to
            Caenorhabditis elegans cell death protein Ced-3 and mammalian
            interleukin-1 beta-converting enzyme
  JOURNAL   J. Biol. Chem. 269 (49), 30761-30764 (1994)
   PUBMED   7983002
REFERENCE   10 (bases 1 to 2714)
  AUTHORS   Olson,R.E., Morello,J.A. and Kieff,E.D.
  TITLE     Antibiotic treatment of oral anaerobic infections
  JOURNAL   J Oral Surg 33 (8), 619-621 (1975)
   PUBMED   1056466
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from U67206.1, AL627395.14,
            DC384804.1, BT006683.1, BC015799.1, BM976488.1 and BQ006259.1.
            On May 30, 2012 this sequence version replaced gi:73623017.
            
            Summary: This gene encodes a member of the cysteine-aspartic acid
            protease (caspase) family. Sequential activation of caspases plays
            a central role in the execution-phase of cell apoptosis. Caspases
            exist as inactive proenzymes which undergo proteolytic processing
            at conserved aspartic residues to produce two subunits, large and
            small, that dimerize to form the active enzyme. The precursor of
            the encoded protein is cleaved by caspase 3 and 10, is activated
            upon cell death stimuli and induces apoptosis. Alternatively
            spliced transcript variants encoding multiple isoforms have been
            observed for this gene. [provided by RefSeq, May 2012].
            
            Transcript Variant: This variant (d, also known as delta and
            alpha'), encodes the longest isoform (delta).
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            RNAseq introns :: mixed/partial sample support ERS025081, ERS025082
                              [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-141               U67206.1           3-143
            142-251             AL627395.14        7738-7847
            252-793             DC384804.1         1-542
            794-1329            BT006683.1         377-912
            1330-2138           BC015799.1         991-1799
            2139-2694           BM976488.1         17-572              c
            2695-2714           BQ006259.1         1-20                c
FEATURES             Location/Qualifiers
     source          1..2714
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="10"
                     /map="10q25"
     gene            1..2714
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /note="caspase 7, apoptosis-related cysteine peptidase"
                     /db_xref="GeneID:840"
                     /db_xref="HGNC:1508"
                     /db_xref="HPRD:03457"
                     /db_xref="MIM:601761"
     exon            1..310
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /inference="alignment:Splign:1.39.8"
     variation       17
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:56204896"
     variation       103
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:28411397"
     variation       142
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:7921977"
     variation       214..215
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace=""
                     /replace="tt"
                     /db_xref="dbSNP:10553596"
     misc_feature    232..234
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /note="upstream in-frame stop codon"
     variation       262
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140427264"
     exon            311..417
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /inference="alignment:Splign:1.39.8"
     CDS             319..1329
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /EC_number="3.4.22.60"
                     /note="isoform delta is encoded by transcript variant d;
                     caspase 7, apoptosis-related cysteine protease; ICE-like
                     apoptotic protease 3; apoptotic protease MCH-3"
                     /codon_start=1
                     /product="caspase-7 isoform delta"
                     /protein_id="NP_203124.1"
                     /db_xref="GI:15718698"
                     /db_xref="CCDS:CCDS7580.1"
                     /db_xref="GeneID:840"
                     /db_xref="HGNC:1508"
                     /db_xref="HPRD:03457"
                     /db_xref="MIM:601761"
                     /translation="
MDCVGWPPGRKWHLEKNTSCGGSSGICASYVTQMADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
"
     misc_feature    484..486
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="proteolytic cleavage site; modified site"
                     /db_xref="HPRD:00476"
     misc_feature    595..1320
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /note="Caspase, interleukin-1 beta converting enzyme (ICE)
                     homologues; Cysteine-dependent aspartate-directed
                     proteases that mediate programmed cell death (apoptosis).
                     Caspases are synthesized as inactive zymogens and
                     activated by proteolysis of the peptide...; Region: CASc;
                     cd00032"
                     /db_xref="CDD:28914"
     misc_feature    order(676..678,850..852,967..969,988..990,1105..1122,
                     1132..1137)
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /note="substrate pocket [chemical binding]; other site"
                     /db_xref="CDD:28914"
     misc_feature    order(847..849,973..975)
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /note="active site"
                     /db_xref="CDD:28914"
     misc_feature    order(991..993,1060..1065,1084..1086,1093..1095,
                     1102..1104,1171..1173,1195..1197,1213..1215,1273..1275,
                     1288..1293,1297..1299,1306..1311)
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:28914"
     misc_feature    order(994..996,1057..1059)
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /note="proteolytic cleavage site; other site"
                     /db_xref="CDD:28914"
     misc_feature    1009..1011
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="proteolytic cleavage site; modified site"
                     /db_xref="HPRD:00476"
     variation       329
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149264619"
     variation       347
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201587909"
     variation       369
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12358524"
     variation       378
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:137892089"
     variation       379
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369498618"
     variation       394
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:77808789"
     variation       405
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:369110611"
     variation       406
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201036297"
     exon            418..527
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /inference="alignment:Splign:1.39.8"
     variation       429
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:11555408"
     variation       452
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147218371"
     variation       461
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:367975864"
     variation       499
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372133111"
     variation       500
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115389257"
     variation       518
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:372587822"
     exon            528..664
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /inference="alignment:Splign:1.39.8"
     variation       554
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148675407"
     variation       577
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112348087"
     variation       585
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141263741"
     variation       618
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150759529"
     exon            665..793
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /inference="alignment:Splign:1.39.8"
     variation       673
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115183028"
     variation       681
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181777209"
     variation       699
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199874997"
     variation       705
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:114786731"
     variation       711
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:143659216"
     variation       721
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202060178"
     variation       722
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146796754"
     variation       726
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2229998"
     variation       753
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144555540"
     variation       780
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:368309877"
     variation       783
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:115421189"
     variation       787
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:72431166"
     exon            794..969
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /inference="alignment:Splign:1.39.8"
     variation       818
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372396520"
     variation       840
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374718188"
     variation       903
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:193124738"
     variation       908
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369067741"
     variation       912
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:116709623"
     variation       918
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143354631"
     variation       929
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201040237"
     variation       951
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:75516871"
     variation       958
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141266925"
     exon            970..1099
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /inference="alignment:Splign:1.39.8"
     variation       976
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373690332"
     variation       977
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376348175"
     variation       985
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187106799"
     variation       1005
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370774542"
     variation       1013
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375409071"
     variation       1014
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146952079"
     variation       1021
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367682197"
     variation       1046
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370400085"
     variation       1085
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:116560793"
     variation       1091
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200665202"
     variation       1097
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:137956734"
     exon            1100..2698
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /inference="alignment:Splign:1.39.8"
     variation       1110
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1127684"
     variation       1117
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200326742"
     variation       1128
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:112264603"
     variation       1158
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:191429899"
     variation       1182
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2227310"
     variation       1197
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2227309"
     variation       1207
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:116437863"
     variation       1217
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:61755278"
     variation       1245
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373028643"
     variation       1257
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377322540"
     variation       1265
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373624501"
     variation       1284..1285
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:35322299"
     variation       1284
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61755279"
     variation       1324
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:78202169"
     variation       1326
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61757658"
     variation       1363
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143800552"
     variation       1387
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:372361034"
     variation       1400
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:76579192"
     variation       1444
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112631326"
     variation       1514
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148146424"
     variation       1619
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4353229"
     variation       1660
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1127685"
     variation       1669
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1127686"
     variation       1680
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:10787498"
     variation       1685
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183912507"
     variation       1702
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:77191867"
     variation       1797
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188652831"
     variation       1891
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141018894"
     variation       2017
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79838074"
     variation       2090
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12247479"
     variation       2095
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:181350515"
     variation       2103
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:116185385"
     variation       2139
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1127687"
     STS             2189..2286
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /standard_name="D10S1306E"
                     /db_xref="UniSTS:151338"
     STS             2216..2451
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /standard_name="RH18047"
                     /db_xref="UniSTS:8837"
     variation       2220
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12247588"
     variation       2329
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150326299"
     variation       2453
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:186832916"
     variation       2495
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:137932518"
     STS             2537..2686
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /standard_name="SHGC-33054"
                     /db_xref="UniSTS:60686"
     variation       2639
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190021522"
     polyA_signal    2667..2672
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
     polyA_site      2694
                     /gene="CASP7"
                     /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3"
ORIGIN      
cccgcgcgcgggctcaactttgtagagcgaggggccaacttggcagagcgcgcggccagctttgcagagagcgccctccagggactatgcgtgcggggacacgggtcgctttgggctcttccacccctgcggagcgcactaccccgagccaggggcggtgcaagccccgcccggccctacccagggcggctcctccctccgcagcgccgagacttttagtttcgctttcgctaaaggggccccagacccttgctgcggagcgacggagagagactgtgccagtcccagccgccctaccgccgtgggaacgatgctgtaatggactgtgttggttggcctccaggcaggaagtggcacttggaaaagaacaccagctgcggtggtagcagtgggatttgtgcttcttatgttacccagatggcagatgatcagggctgtattgaagagcagggggttgaggattcagcaaatgaagattcagtggatgctaagccagaccggtcctcgtttgtaccgtccctcttcagtaagaagaagaaaaatgtcaccatgcgatccatcaagaccacccgggaccgagtgcctacatatcagtacaacatgaattttgaaaagctgggcaaatgcatcataataaacaacaagaactttgataaagtgacaggtatgggcgttcgaaacggaacagacaaagatgccgaggcgctcttcaagtgcttccgaagcctgggttttgacgtgattgtctataatgactgctcttgtgccaagatgcaagatctgcttaaaaaagcttctgaagaggaccatacaaatgccgcctgcttcgcctgcatcctcttaagccatggagaagaaaatgtaatttatgggaaagatggtgtcacaccaataaaggatttgacagcccactttaggggggatagatgcaaaacccttttagagaaacccaaactcttcttcattcaggcttgccgagggaccgagcttgatgatggcatccaggccgactcggggcccatcaatgacacagatgctaatcctcgatacaagatcccagtggaagctgacttcctcttcgcctattccacggttccaggctattactcgtggaggagcccaggaagaggctcctggtttgtgcaagccctctgctccatcctggaggagcacggaaaagacctggaaatcatgcagatcctcaccagggtgaatgacagagttgccaggcactttgagtctcagtctgatgacccacacttccatgagaagaagcagatcccctgtgtggtctccatgctcaccaaggaactctacttcagtcaatagccatatcaggggtacattctagctgagaagcaatgggtcactcattaatgaatcacatttttttatgctcttgaaatattcagaaattctccaggattttaatttcaggaaaatgtattgattcaacagggaagaaactttctggtgctgtcttttgttctctgaattttcagagactttttttataatgttattcatttggtgactgtgtaactttctcttaagattaattttctctttgtatgtctgttaccttgttaatagacttaatacatgcaacagaagtgacttctggagaaagctcatggctgtgtccactgcaattggtggtaacagtggtagagtcatgtttgcacttggcaaaaagaatcccaatgtttgacaaaacacagccaaggggatatttactgctctttattgcagaatgtgggtattgagtgtgatttgaatgatttttcattggcttagggcagattttcatgcaaaagttctcatatgagttagaggagaaaaagcttaatgattctgatatgtatccatcaggatccagtctggaaaacagaaaccattctaggtgtttcaacagagggagtttaatacaggaaattgacttacatagatgataaaagagaagccaaacagcaagaagctgttaccacacccagggctatgaggataatgggaagaggtttggtttcctgtgtccagtagtgggatcatccagaggagctggaaccatggtgggggctgcctagtgggagttaggaccaccaatggattgtggaaaatggagccatgacaagaacaaagccactgactgagatggagtgagctgagacagataagagaataccttggtctcacctatcctgccctcacatcttccaccagcaccttactgcccaggcctatctggaagccacctcaccaaggaccttggaagagcaagggacagtgaggcaggagaagaacaagaaatggatgtaagcctggcccataatgtgaacataagtaatcactaatgctcaacaatttatccattcaatcatttattcattgggttgtcagatagtctatgtatgtgtaaaacaatctgttttggctttatgtgcaaaatctgttatagctttaaaatatatctggaactttttagattattccaagccttattttgagtaaatatttgttacttttagttctataagtgaggaagagtttatggcaaagatttttggcactttgttttcaagatggtgttatcttttgaattcttgataaatgactgtttttttctgcctaatagtaactggttaaaaaacaaatgttcatatttattgattaaaaatgtggttgcttaattcctaaccagaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:840 -> Molecular function: GO:0004190 [aspartic-type endopeptidase activity] evidence: IEA
            GeneID:840 -> Molecular function: GO:0004197 [cysteine-type endopeptidase activity] evidence: TAS
            GeneID:840 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:840 -> Molecular function: GO:0008234 [cysteine-type peptidase activity] evidence: TAS
            GeneID:840 -> Biological process: GO:0001836 [release of cytochrome c from mitochondria] evidence: IEA
            GeneID:840 -> Biological process: GO:0006508 [proteolysis] evidence: IDA
            GeneID:840 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
            GeneID:840 -> Biological process: GO:0006917 [induction of apoptosis] evidence: IEA
            GeneID:840 -> Biological process: GO:0006921 [cellular component disassembly involved in execution phase of apoptosis] evidence: TAS
            GeneID:840 -> Biological process: GO:0007507 [heart development] evidence: IEA
            GeneID:840 -> Biological process: GO:0008635 [activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c] evidence: TAS
            GeneID:840 -> Biological process: GO:0009411 [response to UV] evidence: IEA
            GeneID:840 -> Biological process: GO:0016485 [protein processing] evidence: IEA
            GeneID:840 -> Biological process: GO:0043525 [positive regulation of neuron apoptotic process] evidence: IEA
            GeneID:840 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: TAS
            GeneID:840 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
            GeneID:840 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
            GeneID:840 -> Cellular component: GO:0005737 [cytoplasm] evidence: TAS
            GeneID:840 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
ANNOTATIONS from NCBI Entrez Gene (20130726):
            NP_203124 -> EC 3.4.22.60

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.