2024-03-29 21:49:16, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_033338 2714 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens caspase 7, apoptosis-related cysteine peptidase (CASP7), transcript variant d, mRNA. ACCESSION NM_033338 VERSION NM_033338.5 GI:388596693 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2714) AUTHORS Park,C., Han,S., Lee,K.M., Choi,J.Y., Song,N., Jeon,S., Park,S.K., Ahn,H.S., Shin,H.Y., Kang,H.J., Koo,H.H., Seo,J.J., Choi,J.E. and Kang,D. TITLE Association between CASP7 and CASP14 genetic polymorphisms and the risk of childhood leukemia JOURNAL Hum. Immunol. 73 (7), 736-739 (2012) PUBMED 22548721 REMARK GeneRIF: genetic polynorphism is associated with the risk of childhood leukemia REFERENCE 2 (bases 1 to 2714) AUTHORS Nagano,T., Hashimoto,T., Nakashima,A., Kikkawa,U. and Kamada,S. TITLE X-linked inhibitor of apoptosis protein mediates neddylation by itself but does not function as a NEDD8-E3 ligase for caspase-7 JOURNAL FEBS Lett. 586 (11), 1612-1616 (2012) PUBMED 22584050 REMARK GeneRIF: XIAP does not function as a NEDD8-E3 ligase for caspase-7 in vivo REFERENCE 3 (bases 1 to 2714) AUTHORS Jin,Y., Birlea,S.A., Fain,P.R., Ferrara,T.M., Ben,S., Riccardi,S.L., Cole,J.B., Gowan,K., Holland,P.J., Bennett,D.C., Luiten,R.M., Wolkerstorfer,A., van der Veen,J.P., Hartmann,A., Eichner,S., Schuler,G., van Geel,N., Lambert,J., Kemp,E.H., Gawkrodger,D.J., Weetman,A.P., Taieb,A., Jouary,T., Ezzedine,K., Wallace,M.R., McCormack,W.T., Picardo,M., Leone,G., Overbeck,A., Silverberg,N.B. and Spritz,R.A. TITLE Genome-wide association analyses identify 13 new susceptibility loci for generalized vitiligo JOURNAL Nat. Genet. 44 (6), 676-680 (2012) PUBMED 22561518 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 2714) AUTHORS Boucher,D., Blais,V. and Denault,J.B. TITLE Caspase-7 uses an exosite to promote poly(ADP ribose) polymerase 1 proteolysis JOURNAL Proc. Natl. Acad. Sci. U.S.A. 109 (15), 5669-5674 (2012) PUBMED 22451931 REMARK GeneRIF: Cellular expression of caspase-7 lacking the critical lysine residues resulted in less-efficient PARP and p23 cleavage compared with cells expressing the wild-type peptidase. REFERENCE 5 (bases 1 to 2714) AUTHORS Riedl,S.J., Fuentes-Prior,P., Renatus,M., Kairies,N., Krapp,S., Huber,R., Salvesen,G.S. and Bode,W. TITLE Structural basis for the activation of human procaspase-7 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 98 (26), 14790-14795 (2001) PUBMED 11752425 REFERENCE 6 (bases 1 to 2714) AUTHORS Tiso,N., Pallavicini,A., Muraro,T., Zimbello,R., Apolloni,E., Valle,G., Lanfranchi,G. and Danieli,G.A. TITLE Chromosomal localization of the human genes, CPP32, Mch2, Mch3, and Ich-1, involved in cellular apoptosis JOURNAL Biochem. Biophys. Res. Commun. 225 (3), 983-989 (1996) PUBMED 8780721 REFERENCE 7 (bases 1 to 2714) AUTHORS Lippke,J.A., Gu,Y., Sarnecki,C., Caron,P.R. and Su,M.S. TITLE Identification and characterization of CPP32/Mch2 homolog 1, a novel cysteine protease similar to CPP32 JOURNAL J. Biol. Chem. 271 (4), 1825-1828 (1996) PUBMED 8567622 REFERENCE 8 (bases 1 to 2714) AUTHORS Fernandes-Alnemri,T., Takahashi,A., Armstrong,R., Krebs,J., Fritz,L., Tomaselli,K.J., Wang,L., Yu,Z., Croce,C.M., Salveson,G. et al. TITLE Mch3, a novel human apoptotic cysteine protease highly related to CPP32 JOURNAL Cancer Res. 55 (24), 6045-6052 (1995) PUBMED 8521391 REFERENCE 9 (bases 1 to 2714) AUTHORS Fernandes-Alnemri,T., Litwack,G. and Alnemri,E.S. TITLE CPP32, a novel human apoptotic protein with homology to Caenorhabditis elegans cell death protein Ced-3 and mammalian interleukin-1 beta-converting enzyme JOURNAL J. Biol. Chem. 269 (49), 30761-30764 (1994) PUBMED 7983002 REFERENCE 10 (bases 1 to 2714) AUTHORS Olson,R.E., Morello,J.A. and Kieff,E.D. TITLE Antibiotic treatment of oral anaerobic infections JOURNAL J Oral Surg 33 (8), 619-621 (1975) PUBMED 1056466 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from U67206.1, AL627395.14, DC384804.1, BT006683.1, BC015799.1, BM976488.1 and BQ006259.1. On May 30, 2012 this sequence version replaced gi:73623017. Summary: This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. The precursor of the encoded protein is cleaved by caspase 3 and 10, is activated upon cell death stimuli and induces apoptosis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012]. Transcript Variant: This variant (d, also known as delta and alpha'), encodes the longest isoform (delta). Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-141 U67206.1 3-143 142-251 AL627395.14 7738-7847 252-793 DC384804.1 1-542 794-1329 BT006683.1 377-912 1330-2138 BC015799.1 991-1799 2139-2694 BM976488.1 17-572 c 2695-2714 BQ006259.1 1-20 c FEATURES Location/Qualifiers source 1..2714 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="10" /map="10q25" gene 1..2714 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /note="caspase 7, apoptosis-related cysteine peptidase" /db_xref="GeneID:840" /db_xref="HGNC:1508" /db_xref="HPRD:03457" /db_xref="MIM:601761" exon 1..310 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /inference="alignment:Splign:1.39.8" variation 17 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="" /replace="a" /db_xref="dbSNP:56204896" variation 103 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="g" /db_xref="dbSNP:28411397" variation 142 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:7921977" variation 214..215 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="" /replace="tt" /db_xref="dbSNP:10553596" misc_feature 232..234 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /note="upstream in-frame stop codon" variation 262 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:140427264" exon 311..417 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /inference="alignment:Splign:1.39.8" CDS 319..1329 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /EC_number="3.4.22.60" /note="isoform delta is encoded by transcript variant d; caspase 7, apoptosis-related cysteine protease; ICE-like apoptotic protease 3; apoptotic protease MCH-3" /codon_start=1 /product="caspase-7 isoform delta" /protein_id="NP_203124.1" /db_xref="GI:15718698" /db_xref="CCDS:CCDS7580.1" /db_xref="GeneID:840" /db_xref="HGNC:1508" /db_xref="HPRD:03457" /db_xref="MIM:601761" /translation="
MDCVGWPPGRKWHLEKNTSCGGSSGICASYVTQMADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
" misc_feature 484..486 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /experiment="experimental evidence, no additional details recorded" /note="proteolytic cleavage site; modified site" /db_xref="HPRD:00476" misc_feature 595..1320 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /note="Caspase, interleukin-1 beta converting enzyme (ICE) homologues; Cysteine-dependent aspartate-directed proteases that mediate programmed cell death (apoptosis). Caspases are synthesized as inactive zymogens and activated by proteolysis of the peptide...; Region: CASc; cd00032" /db_xref="CDD:28914" misc_feature order(676..678,850..852,967..969,988..990,1105..1122, 1132..1137) /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /note="substrate pocket [chemical binding]; other site" /db_xref="CDD:28914" misc_feature order(847..849,973..975) /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /note="active site" /db_xref="CDD:28914" misc_feature order(991..993,1060..1065,1084..1086,1093..1095, 1102..1104,1171..1173,1195..1197,1213..1215,1273..1275, 1288..1293,1297..1299,1306..1311) /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:28914" misc_feature order(994..996,1057..1059) /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /note="proteolytic cleavage site; other site" /db_xref="CDD:28914" misc_feature 1009..1011 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /experiment="experimental evidence, no additional details recorded" /note="proteolytic cleavage site; modified site" /db_xref="HPRD:00476" variation 329 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:149264619" variation 347 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="g" /db_xref="dbSNP:201587909" variation 369 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:12358524" variation 378 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:137892089" variation 379 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:369498618" variation 394 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:77808789" variation 405 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="g" /replace="t" /db_xref="dbSNP:369110611" variation 406 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="g" /replace="t" /db_xref="dbSNP:201036297" exon 418..527 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /inference="alignment:Splign:1.39.8" variation 429 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="g" /replace="t" /db_xref="dbSNP:11555408" variation 452 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:147218371" variation 461 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="t" /db_xref="dbSNP:367975864" variation 499 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:372133111" variation 500 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:115389257" variation 518 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="c" /db_xref="dbSNP:372587822" exon 528..664 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /inference="alignment:Splign:1.39.8" variation 554 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:148675407" variation 577 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:112348087" variation 585 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:141263741" variation 618 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:150759529" exon 665..793 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /inference="alignment:Splign:1.39.8" variation 673 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:115183028" variation 681 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:181777209" variation 699 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:199874997" variation 705 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:114786731" variation 711 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="g" /db_xref="dbSNP:143659216" variation 721 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:202060178" variation 722 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:146796754" variation 726 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:2229998" variation 753 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:144555540" variation 780 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="g" /replace="t" /db_xref="dbSNP:368309877" variation 783 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:115421189" variation 787 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="" /replace="a" /db_xref="dbSNP:72431166" exon 794..969 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /inference="alignment:Splign:1.39.8" variation 818 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="g" /db_xref="dbSNP:372396520" variation 840 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="g" /db_xref="dbSNP:374718188" variation 903 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:193124738" variation 908 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:369067741" variation 912 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:116709623" variation 918 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:143354631" variation 929 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="g" /db_xref="dbSNP:201040237" variation 951 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:75516871" variation 958 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:141266925" exon 970..1099 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /inference="alignment:Splign:1.39.8" variation 976 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:373690332" variation 977 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:376348175" variation 985 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:187106799" variation 1005 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:370774542" variation 1013 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:375409071" variation 1014 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:146952079" variation 1021 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:367682197" variation 1046 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:370400085" variation 1085 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:116560793" variation 1091 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:200665202" variation 1097 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:137956734" exon 1100..2698 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /inference="alignment:Splign:1.39.8" variation 1110 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:1127684" variation 1117 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="c" /db_xref="dbSNP:200326742" variation 1128 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="c" /db_xref="dbSNP:112264603" variation 1158 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:191429899" variation 1182 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="g" /db_xref="dbSNP:2227310" variation 1197 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:2227309" variation 1207 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:116437863" variation 1217 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="c" /db_xref="dbSNP:61755278" variation 1245 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:373028643" variation 1257 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:377322540" variation 1265 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:373624501" variation 1284..1285 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="" /replace="c" /db_xref="dbSNP:35322299" variation 1284 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:61755279" variation 1324 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="c" /db_xref="dbSNP:78202169" variation 1326 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:61757658" variation 1363 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:143800552" variation 1387 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="" /replace="t" /db_xref="dbSNP:372361034" variation 1400 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:76579192" variation 1444 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:112631326" variation 1514 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:148146424" variation 1619 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:4353229" variation 1660 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:1127685" variation 1669 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:1127686" variation 1680 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="g" /replace="t" /db_xref="dbSNP:10787498" variation 1685 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:183912507" variation 1702 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:77191867" variation 1797 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:188652831" variation 1891 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:141018894" variation 2017 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:79838074" variation 2090 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:12247479" variation 2095 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:181350515" variation 2103 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:116185385" variation 2139 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:1127687" STS 2189..2286 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /standard_name="D10S1306E" /db_xref="UniSTS:151338" STS 2216..2451 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /standard_name="RH18047" /db_xref="UniSTS:8837" variation 2220 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:12247588" variation 2329 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:150326299" variation 2453 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="g" /replace="t" /db_xref="dbSNP:186832916" variation 2495 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="c" /replace="t" /db_xref="dbSNP:137932518" STS 2537..2686 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /standard_name="SHGC-33054" /db_xref="UniSTS:60686" variation 2639 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" /replace="a" /replace="g" /db_xref="dbSNP:190021522" polyA_signal 2667..2672 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" polyA_site 2694 /gene="CASP7" /gene_synonym="CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3" ORIGIN
cccgcgcgcgggctcaactttgtagagcgaggggccaacttggcagagcgcgcggccagctttgcagagagcgccctccagggactatgcgtgcggggacacgggtcgctttgggctcttccacccctgcggagcgcactaccccgagccaggggcggtgcaagccccgcccggccctacccagggcggctcctccctccgcagcgccgagacttttagtttcgctttcgctaaaggggccccagacccttgctgcggagcgacggagagagactgtgccagtcccagccgccctaccgccgtgggaacgatgctgtaatggactgtgttggttggcctccaggcaggaagtggcacttggaaaagaacaccagctgcggtggtagcagtgggatttgtgcttcttatgttacccagatggcagatgatcagggctgtattgaagagcagggggttgaggattcagcaaatgaagattcagtggatgctaagccagaccggtcctcgtttgtaccgtccctcttcagtaagaagaagaaaaatgtcaccatgcgatccatcaagaccacccgggaccgagtgcctacatatcagtacaacatgaattttgaaaagctgggcaaatgcatcataataaacaacaagaactttgataaagtgacaggtatgggcgttcgaaacggaacagacaaagatgccgaggcgctcttcaagtgcttccgaagcctgggttttgacgtgattgtctataatgactgctcttgtgccaagatgcaagatctgcttaaaaaagcttctgaagaggaccatacaaatgccgcctgcttcgcctgcatcctcttaagccatggagaagaaaatgtaatttatgggaaagatggtgtcacaccaataaaggatttgacagcccactttaggggggatagatgcaaaacccttttagagaaacccaaactcttcttcattcaggcttgccgagggaccgagcttgatgatggcatccaggccgactcggggcccatcaatgacacagatgctaatcctcgatacaagatcccagtggaagctgacttcctcttcgcctattccacggttccaggctattactcgtggaggagcccaggaagaggctcctggtttgtgcaagccctctgctccatcctggaggagcacggaaaagacctggaaatcatgcagatcctcaccagggtgaatgacagagttgccaggcactttgagtctcagtctgatgacccacacttccatgagaagaagcagatcccctgtgtggtctccatgctcaccaaggaactctacttcagtcaatagccatatcaggggtacattctagctgagaagcaatgggtcactcattaatgaatcacatttttttatgctcttgaaatattcagaaattctccaggattttaatttcaggaaaatgtattgattcaacagggaagaaactttctggtgctgtcttttgttctctgaattttcagagactttttttataatgttattcatttggtgactgtgtaactttctcttaagattaattttctctttgtatgtctgttaccttgttaatagacttaatacatgcaacagaagtgacttctggagaaagctcatggctgtgtccactgcaattggtggtaacagtggtagagtcatgtttgcacttggcaaaaagaatcccaatgtttgacaaaacacagccaaggggatatttactgctctttattgcagaatgtgggtattgagtgtgatttgaatgatttttcattggcttagggcagattttcatgcaaaagttctcatatgagttagaggagaaaaagcttaatgattctgatatgtatccatcaggatccagtctggaaaacagaaaccattctaggtgtttcaacagagggagtttaatacaggaaattgacttacatagatgataaaagagaagccaaacagcaagaagctgttaccacacccagggctatgaggataatgggaagaggtttggtttcctgtgtccagtagtgggatcatccagaggagctggaaccatggtgggggctgcctagtgggagttaggaccaccaatggattgtggaaaatggagccatgacaagaacaaagccactgactgagatggagtgagctgagacagataagagaataccttggtctcacctatcctgccctcacatcttccaccagcaccttactgcccaggcctatctggaagccacctcaccaaggaccttggaagagcaagggacagtgaggcaggagaagaacaagaaatggatgtaagcctggcccataatgtgaacataagtaatcactaatgctcaacaatttatccattcaatcatttattcattgggttgtcagatagtctatgtatgtgtaaaacaatctgttttggctttatgtgcaaaatctgttatagctttaaaatatatctggaactttttagattattccaagccttattttgagtaaatatttgttacttttagttctataagtgaggaagagtttatggcaaagatttttggcactttgttttcaagatggtgttatcttttgaattcttgataaatgactgtttttttctgcctaatagtaactggttaaaaaacaaatgttcatatttattgattaaaaatgtggttgcttaattcctaaccagaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:840 -> Molecular function: GO:0004190 [aspartic-type endopeptidase activity] evidence: IEA GeneID:840 -> Molecular function: GO:0004197 [cysteine-type endopeptidase activity] evidence: TAS GeneID:840 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:840 -> Molecular function: GO:0008234 [cysteine-type peptidase activity] evidence: TAS GeneID:840 -> Biological process: GO:0001836 [release of cytochrome c from mitochondria] evidence: IEA GeneID:840 -> Biological process: GO:0006508 [proteolysis] evidence: IDA GeneID:840 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS GeneID:840 -> Biological process: GO:0006917 [induction of apoptosis] evidence: IEA GeneID:840 -> Biological process: GO:0006921 [cellular component disassembly involved in execution phase of apoptosis] evidence: TAS GeneID:840 -> Biological process: GO:0007507 [heart development] evidence: IEA GeneID:840 -> Biological process: GO:0008635 [activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c] evidence: TAS GeneID:840 -> Biological process: GO:0009411 [response to UV] evidence: IEA GeneID:840 -> Biological process: GO:0016485 [protein processing] evidence: IEA GeneID:840 -> Biological process: GO:0043525 [positive regulation of neuron apoptotic process] evidence: IEA GeneID:840 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: TAS GeneID:840 -> Cellular component: GO:0005634 [nucleus] evidence: IDA GeneID:840 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS GeneID:840 -> Cellular component: GO:0005737 [cytoplasm] evidence: TAS GeneID:840 -> Cellular component: GO:0005829 [cytosol] evidence: TAS ANNOTATIONS from NCBI Entrez Gene (20130726): NP_203124 -> EC 3.4.22.60
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.