Home |
Help |
Advanced search
2024-04-20 12:31:47, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_033164 1003 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens fibroblast growth factor 8 (androgen-induced) (FGF8),
transcript variant E, mRNA.
ACCESSION NM_033164
VERSION NM_033164.3 GI:298919214
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1003)
AUTHORS Wang,W., Chen,X., Li,T., Li,Y., Wang,R., He,D., Luo,W., Li,X. and
Wu,X.
TITLE Screening a phage display library for a novel FGF8b-binding peptide
with anti-tumor effect on prostate cancer
JOURNAL Exp. Cell Res. 319 (8), 1156-1164 (2013)
PUBMED 23466786
REMARK GeneRIF: A novel FGF8b-binding peptide with anti-tumor effect on
prostate cancer.
REFERENCE 2 (bases 1 to 1003)
AUTHORS Costa-Barbosa,F.A., Balasubramanian,R., Keefe,K.W., Shaw,N.D.,
Al-Tassan,N., Plummer,L., Dwyer,A.A., Buck,C.L., Choi,J.H.,
Seminara,S.B., Quinton,R., Monies,D., Meyer,B., Hall,J.E.,
Pitteloud,N. and Crowley,W.F. Jr.
TITLE Prioritizing genetic testing in patients with Kallmann syndrome
using clinical phenotypes
JOURNAL J. Clin. Endocrinol. Metab. 98 (5), E943-E953 (2013)
PUBMED 23533228
REMARK GeneRIF: genetic association study in population in Massachusetts:
Data suggest that clinical features in Kallmann syndrome (KS) are
associated with genetic causes: dental agenesis/digital bony
abnormalities are associated with variations/mutations in FGF8.
REFERENCE 3 (bases 1 to 1003)
AUTHORS Elo,T., Sipila,P., Valve,E., Kujala,P., Toppari,J., Poutanen,M. and
Harkonen,P.
TITLE Fibroblast growth factor 8b causes progressive stromal and
epithelial changes in the epididymis and degeneration of the
seminiferous epithelium in the testis of transgenic mice
JOURNAL Biol. Reprod. 86 (5), 157 (2012)
PUBMED 22423049
REMARK GeneRIF: The results suggest that prolonged and enhanced human
fibroblast growth factor 8b signaling induces dramatic changes in
the epididymis and testis that lead to infertility in a portion of
the human fibroblast growth factor 8b transgenic male mice.
Publication Status: Online-Only
REFERENCE 4 (bases 1 to 1003)
AUTHORS Yoshiura,K., Leysens,N.J., Chang,J., Ward,D., Murray,J.C. and
Muenke,M.
TITLE Genomic structure, sequence, and mapping of human FGF8 with no
evidence for its role in craniosynostosis/limb defect syndromes
JOURNAL Am. J. Med. Genet. 72 (3), 354-362 (1997)
PUBMED 9332670
REFERENCE 5 (bases 1 to 1003)
AUTHORS Ghosh,A.K., Shankar,D.B., Shackleford,G.M., Wu,K., T'Ang,A.,
Miller,G.J., Zheng,J. and Roy-Burman,P.
TITLE Molecular cloning and characterization of human FGF8 alternative
messenger RNA forms
JOURNAL Cell Growth Differ. 7 (10), 1425-1434 (1996)
PUBMED 8891346
REFERENCE 6 (bases 1 to 1003)
AUTHORS Payson,R.A., Wu,J., Liu,Y. and Chiu,I.M.
TITLE The human FGF-8 gene localizes on chromosome 10q24 and is subjected
to induction by androgen in breast cancer cells
JOURNAL Oncogene 13 (1), 47-53 (1996)
PUBMED 8700553
REFERENCE 7 (bases 1 to 1003)
AUTHORS Gemel,J., Gorry,M., Ehrlich,G.D. and MacArthur,C.A.
TITLE Structure and sequence of human FGF8
JOURNAL Genomics 35 (1), 253-257 (1996)
PUBMED 8661131
REFERENCE 8 (bases 1 to 1003)
AUTHORS Ornitz,D.M., Xu,J., Colvin,J.S., McEwen,D.G., MacArthur,C.A.,
Coulier,F., Gao,G. and Goldfarb,M.
TITLE Receptor specificity of the fibroblast growth factor family
JOURNAL J. Biol. Chem. 271 (25), 15292-15297 (1996)
PUBMED 8663044
REFERENCE 9 (bases 1 to 1003)
AUTHORS White,R.A., Dowler,L.L., Angeloni,S.V., Pasztor,L.M. and
MacArthur,C.A.
TITLE Assignment of FGF8 to human chromosome 10q25-q26: mutations in FGF8
may be responsible for some types of acrocephalosyndactyly linked
to this region
JOURNAL Genomics 30 (1), 109-111 (1995)
PUBMED 8595889
REFERENCE 10 (bases 1 to 1003)
AUTHORS Tanaka,A., Miyamoto,K., Matsuo,H., Matsumoto,K. and Yoshida,H.
TITLE Human androgen-induced growth factor in prostate and breast cancer
cells: its molecular cloning and growth properties
JOURNAL FEBS Lett. 363 (3), 226-230 (1995)
PUBMED 7737407
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BC128236.1, U46213.1 and
AC010789.9.
On Jun 22, 2010 this sequence version replaced gi:170763473.
Summary: The protein encoded by this gene is a member of the
fibroblast growth factor (FGF) family. FGF family members possess
broad mitogenic and cell survival activities, and are involved in a
variety of biological processes, including embryonic development,
cell growth, morphogenesis, tissue repair, tumor growth and
invasion. This protein is known to be a factor that supports
androgen and anchorage independent growth of mammary tumor cells.
Overexpression of this gene has been shown to increase tumor growth
and angiogensis. The adult expression of this gene is restricted to
testes and ovaries. Temporal and spatial pattern of this gene
expression suggests its function as an embryonic epithelial factor.
Studies of the mouse and chick homologs revealed roles in midbrain
and limb development, organogenesis, embryo gastrulation and
left-right axis determination. The alternative splicing of this
gene results in four transcript variants. [provided by RefSeq, Jul
2008].
Transcript Variant: This variant (E) uses an alternate splice site,
compared to variant F. The encoded isoform (E) is shorter than
isoform F.
Sequence Note: This RefSeq record was created from transcript and
genomic sequence data to make the sequence consistent with the
reference genome assembly. The genomic coordinates used for the
transcript record were based on transcript alignments.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: U46213.1 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
ERS025084 [ECO:0000350]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-102 BC128236.1 1-102
103-446 U46213.1 1-344
447-447 AC010789.9 100226-100226 c
448-791 U46213.1 346-689
792-1003 AC010789.9 98827-99038 c
FEATURES Location/Qualifiers
source 1..1003
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="10"
/map="10q24"
gene 1..1003
/gene="FGF8"
/gene_synonym="AIGF; FGF-8; HBGF-8; HH6; KAL6"
/note="fibroblast growth factor 8 (androgen-induced)"
/db_xref="GeneID:2253"
/db_xref="HGNC:3686"
/db_xref="HPRD:02727"
/db_xref="MIM:600483"
exon 1..134
/gene="FGF8"
/gene_synonym="AIGF; FGF-8; HBGF-8; HH6; KAL6"
/inference="alignment:Splign:1.39.8"
STS 25..841
/gene="FGF8"
/gene_synonym="AIGF; FGF-8; HBGF-8; HH6; KAL6"
/db_xref="UniSTS:483139"
variation 39
/gene="FGF8"
/gene_synonym="AIGF; FGF-8; HBGF-8; HH6; KAL6"
/replace="a"
/replace="c"
/db_xref="dbSNP:2735432"
CDS 103..804
/gene="FGF8"
/gene_synonym="AIGF; FGF-8; HBGF-8; HH6; KAL6"
/note="isoform E precursor is encoded by transcript
variant E; heparin-binding growth factor 8;
androgen-induced growth factor"
/codon_start=1
/product="fibroblast growth factor 8 isoform E precursor"
/protein_id="NP_149354.1"
/db_xref="GI:15147348"
/db_xref="CCDS:CCDS7517.1"
/db_xref="GeneID:2253"
/db_xref="HGNC:3686"
/db_xref="HPRD:02727"
/db_xref="MIM:600483"
/translation="
MGSPRSALSCLLLHLLVLCLQAQEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
"
sig_peptide 103..168
/gene="FGF8"
/gene_synonym="AIGF; FGF-8; HBGF-8; HH6; KAL6"
/inference="COORDINATES: ab initio prediction:SignalP:4.0"
mat_peptide 169..801
/gene="FGF8"
/gene_synonym="AIGF; FGF-8; HBGF-8; HH6; KAL6"
/product="fibroblast growth factor 8 isoform E"
misc_feature 316..690
/gene="FGF8"
/gene_synonym="AIGF; FGF-8; HBGF-8; HH6; KAL6"
/note="Acidic and basic fibroblast growth factor family;
FGFs are mitogens, which stimulate growth or
differentiation of cells of mesodermal or neuroectodermal
origin. The family plays essential roles in patterning and
differentiation during vertebrate...; Region: FGF;
cd00058"
/db_xref="CDD:28940"
misc_feature order(316..318,325..327,421..423,427..429,433..435,
523..525,547..549,556..573,577..579,673..675,679..681,
685..687)
/gene="FGF8"
/gene_synonym="AIGF; FGF-8; HBGF-8; HH6; KAL6"
/note="receptor interaction site; other site"
/db_xref="CDD:28940"
misc_feature order(616..621,634..636,646..648,664..666)
/gene="FGF8"
/gene_synonym="AIGF; FGF-8; HBGF-8; HH6; KAL6"
/note="heparin binding site (glycine box) [chemical
binding]; other site"
/db_xref="CDD:28940"
STS 124..745
/gene="FGF8"
/gene_synonym="AIGF; FGF-8; HBGF-8; HH6; KAL6"
/standard_name="Fgf8"
/db_xref="UniSTS:258274"
exon 135..171
/gene="FGF8"
/gene_synonym="AIGF; FGF-8; HBGF-8; HH6; KAL6"
/inference="alignment:Splign:1.39.8"
STS 137..333
/gene="FGF8"
/gene_synonym="AIGF; FGF-8; HBGF-8; HH6; KAL6"
/standard_name="Fgf8"
/db_xref="UniSTS:506892"
exon 172..258
/gene="FGF8"
/gene_synonym="AIGF; FGF-8; HBGF-8; HH6; KAL6"
/inference="alignment:Splign:1.39.8"
exon 259..406
/gene="FGF8"
/gene_synonym="AIGF; FGF-8; HBGF-8; HH6; KAL6"
/inference="alignment:Splign:1.39.8"
exon 407..513
/gene="FGF8"
/gene_synonym="AIGF; FGF-8; HBGF-8; HH6; KAL6"
/inference="alignment:Splign:1.39.8"
variation 447
/gene="FGF8"
/gene_synonym="AIGF; FGF-8; HBGF-8; HH6; KAL6"
/replace="c"
/replace="t"
/db_xref="dbSNP:1048331"
exon 514..1003
/gene="FGF8"
/gene_synonym="AIGF; FGF-8; HBGF-8; HH6; KAL6"
/inference="alignment:Splign:1.39.8"
STS 542..677
/gene="FGF8"
/gene_synonym="AIGF; FGF-8; HBGF-8; HH6; KAL6"
/standard_name="RH18043"
/db_xref="UniSTS:64634"
STS 564..785
/gene="FGF8"
/gene_synonym="AIGF; FGF-8; HBGF-8; HH6; KAL6"
/standard_name="D1Bda63"
/db_xref="UniSTS:239816"
variation 792
/gene="FGF8"
/gene_synonym="AIGF; FGF-8; HBGF-8; HH6; KAL6"
/replace="c"
/replace="g"
/db_xref="dbSNP:1071634"
variation 928
/gene="FGF8"
/gene_synonym="AIGF; FGF-8; HBGF-8; HH6; KAL6"
/replace="c"
/replace="g"
/db_xref="dbSNP:3218239"
variation 969
/gene="FGF8"
/gene_synonym="AIGF; FGF-8; HBGF-8; HH6; KAL6"
/replace=""
/replace="t"
/replace="ttttt"
/db_xref="dbSNP:71016346"
ORIGIN
acccgcaccctctccgctcgcgccctgctcagcgcgtcctcccgcggcggcccgcgggacggcgtgacccgccgggctctcggtgccccggggccgcgcgccatgggcagcccccgctccgcgctgagctgcctgctgttgcacttgctggtcctctgcctccaagcccaggaaggcccgggcaggggccctgcgctgggcagggagctcgcttccctgttccgggctggccgggagccccagggtgtctcccaacagcatgtgagggagcagagcctggtgacggatcagctcagccgccgcctcatccggacctaccaactctacagccgcaccagcgggaagcacgtgcaggtcctggccaacaagcgcatcaacgccatggcagaggacggcgaccccttcgcaaagctcatcgtggagacggacacctttggaagcagagttcgagtccgaggagccgagacgggcctctacatctgcatgaacaagaaggggaagctgatcgccaagagcaacggcaaaggcaaggactgcgtcttcacggagattgtgctggagaacaactacacagcgctgcagaatgccaagtacgagggctggtacatggccttcacccgcaagggccggccccgcaagggctccaagacgcggcagcaccagcgtgaggtccacttcatgaagcggctgccccggggccaccacaccaccgagcagagcctgcgcttcgagttcctcaactacccgcccttcacgcgcagcctgcgcggcagccagaggacttgggcccccgagccccgataggtgctgcctggccctccccacaatgccagaccgcagagaggctcatcctgtagggcacccaaaactcaagcaagatgagctgtgcgctgctctgcaggctggggaggtgctgggggagccctgggttccggttgttgatattgtttgctgttgggtttttgctgtttttttttttttttttttttttaaaacaaaagag
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:2253 -> Molecular function: GO:0005105 [type 1 fibroblast growth factor receptor binding] evidence: IDA
GeneID:2253 -> Molecular function: GO:0005111 [type 2 fibroblast growth factor receptor binding] evidence: IDA
GeneID:2253 -> Molecular function: GO:0008083 [growth factor activity] evidence: IDA
GeneID:2253 -> Molecular function: GO:0008083 [growth factor activity] evidence: IEA
GeneID:2253 -> Biological process: GO:0000165 [MAPK cascade] evidence: IEA
GeneID:2253 -> Biological process: GO:0001569 [patterning of blood vessels] evidence: IEA
GeneID:2253 -> Biological process: GO:0001656 [metanephros development] evidence: IEP
GeneID:2253 -> Biological process: GO:0001658 [branching involved in ureteric bud morphogenesis] evidence: IEA
GeneID:2253 -> Biological process: GO:0001759 [organ induction] evidence: IEA
GeneID:2253 -> Biological process: GO:0001823 [mesonephros development] evidence: IEP
GeneID:2253 -> Biological process: GO:0001839 [neural plate morphogenesis] evidence: IEA
GeneID:2253 -> Biological process: GO:0001947 [heart looping] evidence: IEA
GeneID:2253 -> Biological process: GO:0001974 [blood vessel remodeling] evidence: IEA
GeneID:2253 -> Biological process: GO:0003148 [outflow tract septum morphogenesis] evidence: ISS
GeneID:2253 -> Biological process: GO:0003198 [epithelial to mesenchymal transition involved in endocardial cushion formation] evidence: ISS
GeneID:2253 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:2253 -> Biological process: GO:0007173 [epidermal growth factor receptor signaling pathway] evidence: TAS
GeneID:2253 -> Biological process: GO:0007369 [gastrulation] evidence: NAS
GeneID:2253 -> Biological process: GO:0008078 [mesodermal cell migration] evidence: IEA
GeneID:2253 -> Biological process: GO:0008284 [positive regulation of cell proliferation] evidence: IDA
GeneID:2253 -> Biological process: GO:0008284 [positive regulation of cell proliferation] evidence: IEA
GeneID:2253 -> Biological process: GO:0008286 [insulin receptor signaling pathway] evidence: TAS
GeneID:2253 -> Biological process: GO:0008406 [gonad development] evidence: IMP
GeneID:2253 -> Biological process: GO:0008543 [fibroblast growth factor receptor signaling pathway] evidence: IGI
GeneID:2253 -> Biological process: GO:0008543 [fibroblast growth factor receptor signaling pathway] evidence: TAS
GeneID:2253 -> Biological process: GO:0009653 [anatomical structure morphogenesis] evidence: NAS
GeneID:2253 -> Biological process: GO:0010628 [positive regulation of gene expression] evidence: IEA
GeneID:2253 -> Biological process: GO:0021543 [pallium development] evidence: IEA
GeneID:2253 -> Biological process: GO:0021544 [subpallium development] evidence: IEA
GeneID:2253 -> Biological process: GO:0021798 [forebrain dorsal/ventral pattern formation] evidence: IEA
GeneID:2253 -> Biological process: GO:0021846 [cell proliferation in forebrain] evidence: IEA
GeneID:2253 -> Biological process: GO:0023019 [signal transduction involved in regulation of gene expression] evidence: IEA
GeneID:2253 -> Biological process: GO:0030509 [BMP signaling pathway] evidence: IEA
GeneID:2253 -> Biological process: GO:0030539 [male genitalia development] evidence: IEA
GeneID:2253 -> Biological process: GO:0030878 [thyroid gland development] evidence: IEA
GeneID:2253 -> Biological process: GO:0030916 [otic vesicle formation] evidence: IEA
GeneID:2253 -> Biological process: GO:0030917 [midbrain-hindbrain boundary development] evidence: IEA
GeneID:2253 -> Biological process: GO:0035116 [embryonic hindlimb morphogenesis] evidence: IEA
GeneID:2253 -> Biological process: GO:0035909 [aorta morphogenesis] evidence: IEA
GeneID:2253 -> Biological process: GO:0038095 [Fc-epsilon receptor signaling pathway] evidence: TAS
GeneID:2253 -> Biological process: GO:0042476 [odontogenesis] evidence: IEP
GeneID:2253 -> Biological process: GO:0042487 [regulation of odontogenesis of dentin-containing tooth] evidence: IEA
GeneID:2253 -> Biological process: GO:0043524 [negative regulation of neuron apoptotic process] evidence: IEA
GeneID:2253 -> Biological process: GO:0045087 [innate immune response] evidence: TAS
GeneID:2253 -> Biological process: GO:0045840 [positive regulation of mitosis] evidence: IEA
GeneID:2253 -> Biological process: GO:0046622 [positive regulation of organ growth] evidence: IEA
GeneID:2253 -> Biological process: GO:0048011 [neurotrophin TRK receptor signaling pathway] evidence: TAS
GeneID:2253 -> Biological process: GO:0048015 [phosphatidylinositol-mediated signaling] evidence: TAS
GeneID:2253 -> Biological process: GO:0048853 [forebrain morphogenesis] evidence: IEA
GeneID:2253 -> Biological process: GO:0051781 [positive regulation of cell division] evidence: IEA
GeneID:2253 -> Biological process: GO:0055026 [negative regulation of cardiac muscle tissue development] evidence: IMP
GeneID:2253 -> Biological process: GO:0060037 [pharyngeal system development] evidence: IEA
GeneID:2253 -> Biological process: GO:0060070 [canonical Wnt receptor signaling pathway] evidence: IEA
GeneID:2253 -> Biological process: GO:0060128 [corticotropin hormone secreting cell differentiation] evidence: IEA
GeneID:2253 -> Biological process: GO:0060129 [thyroid-stimulating hormone-secreting cell differentiation] evidence: IEA
GeneID:2253 -> Biological process: GO:0060348 [bone development] evidence: IMP
GeneID:2253 -> Biological process: GO:0060425 [lung morphogenesis] evidence: IEA
GeneID:2253 -> Biological process: GO:0060445 [branching involved in salivary gland morphogenesis] evidence: IEA
GeneID:2253 -> Biological process: GO:0060563 [neuroepithelial cell differentiation] evidence: IDA
GeneID:2253 -> Biological process: GO:0071542 [dopaminergic neuron differentiation] evidence: IDA
GeneID:2253 -> Biological process: GO:0090134 [cell migration involved in mesendoderm migration] evidence: IEA
GeneID:2253 -> Cellular component: GO:0005576 [extracellular region] evidence: TAS
GeneID:2253 -> Cellular component: GO:0005615 [extracellular space] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.