2024-04-25 15:37:19, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_032992 1394 bp mRNA linear PRI 08-JUN-2013 DEFINITION Homo sapiens caspase 6, apoptosis-related cysteine peptidase (CASP6), transcript variant beta, mRNA. ACCESSION NM_032992 VERSION NM_032992.2 GI:73622127 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1394) AUTHORS Velazquez-Delgado,E.M. and Hardy,J.A. TITLE Zinc-mediated allosteric inhibition of caspase-6 JOURNAL J. Biol. Chem. 287 (43), 36000-36011 (2012) PUBMED 22891250 REMARK GeneRIF: binding of zinc at the exosite is the primary route of inhibition, potentially locking caspase-6 into the inactive helical conformation. Erratum:[J Biol Chem. 2013 Apr 19;288(16):11508] REFERENCE 2 (bases 1 to 1394) AUTHORS Stanger,K., Steffek,M., Zhou,L., Pozniak,C.D., Quan,C., Franke,Y., Tom,J., Tam,C., Krylova,I., Elliott,J.M., Lewcock,J.W., Zhang,Y., Murray,J. and Hannoush,R.N. TITLE Allosteric peptides bind a caspase zymogen and mediate caspase tetramerization JOURNAL Nat. Chem. Biol. 8 (7), 655-660 (2012) PUBMED 22683611 REMARK GeneRIF: peptide binds at a tetramerization interface that is uniquely present in zymogen caspase-6, rather than binding into the active site, and acts via a new allosteric mechanism that promotes caspase tetramerization Erratum:[Nat Chem Biol. 2012 Jul;8(7). doi: 10.1038/nchembio.967. Krylova, Irina [added]] REFERENCE 3 (bases 1 to 1394) AUTHORS Cao,Q., Wang,X.J., Liu,C.W., Liu,D.F., Li,L.F., Gao,Y.Q. and Su,X.D. TITLE Inhibitory mechanism of caspase-6 phosphorylation revealed by crystal structures, molecular dynamics simulations, and biochemical assays JOURNAL J. Biol. Chem. 287 (19), 15371-15379 (2012) PUBMED 22433863 REMARK GeneRIF: Results showed the inhibition mechanism of CASP6 phosphorylation and laid the foundation for a new strategy of rational CASP6 drug design. REFERENCE 4 (bases 1 to 1394) AUTHORS Soares,J., Lowe,M.M. and Jarstfer,M.B. TITLE The catalytic subunit of human telomerase is a unique caspase-6 and caspase-7 substrate JOURNAL Biochemistry 50 (42), 9046-9055 (2011) PUBMED 21936563 REMARK GeneRIF: Caspase-6 cleaves human TERT at residues E129 and D637 as part of the apoptosis pathway in cultured cells. REFERENCE 5 (bases 1 to 1394) AUTHORS Muller,I., Lamers,M.B., Ritchie,A.J., Park,H., Dominguez,C., Munoz-Sanjuan,I., Maillard,M. and Kiselyov,A. TITLE A new apo-caspase-6 crystal form reveals the active conformation of the apoenzyme JOURNAL J. Mol. Biol. 410 (2), 307-315 (2011) PUBMED 21621544 REMARK GeneRIF: New crystal form of apo-caspase-6 is presented in canonical conformation by identifying the previous apostructure as a hydrogen-ion concentration (pH)-inactivated form of caspase-6. REFERENCE 6 (bases 1 to 1394) AUTHORS Bullrich,F., Fernandes-Alnemri,T., Litwack,G., Alnemri,E.S. and Croce,C.M. TITLE Chromosomal mapping of cell death proteases CPP32, MCH2, and MCH3 JOURNAL Genomics 36 (2), 362-365 (1996) PUBMED 8812467 REFERENCE 7 (bases 1 to 1394) AUTHORS Tiso,N., Pallavicini,A., Muraro,T., Zimbello,R., Apolloni,E., Valle,G., Lanfranchi,G. and Danieli,G.A. TITLE Chromosomal localization of the human genes, CPP32, Mch2, Mch3, and Ich-1, involved in cellular apoptosis JOURNAL Biochem. Biophys. Res. Commun. 225 (3), 983-989 (1996) PUBMED 8780721 REFERENCE 8 (bases 1 to 1394) AUTHORS Takahashi,A., Alnemri,E.S., Lazebnik,Y.A., Fernandes-Alnemri,T., Litwack,G., Moir,R.D., Goldman,R.D., Poirier,G.G., Kaufmann,S.H. and Earnshaw,W.C. TITLE Cleavage of lamin A by Mch2 alpha but not CPP32: multiple interleukin 1 beta-converting enzyme-related proteases with distinct substrate recognition properties are active in apoptosis JOURNAL Proc. Natl. Acad. Sci. U.S.A. 93 (16), 8395-8400 (1996) PUBMED 8710882 REFERENCE 9 (bases 1 to 1394) AUTHORS Fernandes-Alnemri,T., Litwack,G. and Alnemri,E.S. TITLE Mch2, a new member of the apoptotic Ced-3/Ice cysteine protease gene family JOURNAL Cancer Res. 55 (13), 2737-2742 (1995) PUBMED 7796396 REFERENCE 10 (bases 1 to 1394) AUTHORS Fernandes-Alnemri,T., Litwack,G. and Alnemri,E.S. TITLE CPP32, a novel human apoptotic protein with homology to Caenorhabditis elegans cell death protein Ced-3 and mammalian interleukin-1 beta-converting enzyme JOURNAL J. Biol. Chem. 269 (49), 30761-30764 (1994) PUBMED 7983002 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from U20536.1, U20537.1, BM837197.1 and AC004067.1. On Aug 19, 2005 this sequence version replaced gi:14916484. Summary: This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein is processed by caspases 7, 8 and 10, and is thought to function as a downstream enzyme in the caspase activation cascade. Alternative splicing of this gene results in two transcript variants that encode different isoforms. [provided by RefSeq, Jul 2008]. Transcript Variant: This variant (beta) lacks several exons in the coding region but maintains the reading frame, compared to variant alpha. It encodes isoform beta which is shorter than isoform alpha. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: U20537.1, BM837197.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025092 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-78 U20536.1 1-78 79-289 U20537.1 1-211 290-734 BM837197.1 236-680 735-1394 AC004067.1 116153-116812 c FEATURES Location/Qualifiers source 1..1394 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="4" /map="4q25" gene 1..1394 /gene="CASP6" /gene_synonym="MCH2" /note="caspase 6, apoptosis-related cysteine peptidase" /db_xref="GeneID:839" /db_xref="HGNC:1507" /db_xref="HPRD:03321" /db_xref="MIM:601532" exon 1..118 /gene="CASP6" /gene_synonym="MCH2" /inference="alignment:Splign:1.39.8" CDS 79..693 /gene="CASP6" /gene_synonym="MCH2" /EC_number="3.4.22.59" /note="isoform beta is encoded by transcript variant beta; caspase 6, apoptosis-related cysteine protease; apoptotic protease MCH-2" /codon_start=1 /product="caspase-6 isoform beta" /protein_id="NP_116787.1" /db_xref="GI:14916485" /db_xref="CCDS:CCDS3685.1" /db_xref="GeneID:839" /db_xref="HGNC:1507" /db_xref="HPRD:03321" /db_xref="MIM:601532" /translation="
MSSASGLRRGHPAVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN
" misc_feature <118..678 /gene="CASP6" /gene_synonym="MCH2" /note="Caspase, interleukin-1 beta converting enzyme (ICE) homologues; Cysteine-dependent aspartate-directed proteases that mediate programmed cell death (apoptosis). Caspases are synthesized as inactive zymogens and activated by proteolysis of the peptide...; Region: CASc; cd00032" /db_xref="CDD:28914" misc_feature order(172..174,298..300) /gene="CASP6" /gene_synonym="MCH2" /note="active site" /db_xref="CDD:28914" misc_feature order(175..177,292..294,313..315,460..477,487..492) /gene="CASP6" /gene_synonym="MCH2" /note="substrate pocket [chemical binding]; other site" /db_xref="CDD:28914" misc_feature order(316..318,415..420,439..441,448..450,457..459, 526..528,550..552,568..570,628..630,643..648,652..654, 661..666) /gene="CASP6" /gene_synonym="MCH2" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:28914" misc_feature order(319..321,412..414) /gene="CASP6" /gene_synonym="MCH2" /note="proteolytic cleavage site; other site" /db_xref="CDD:28914" misc_feature 346..348 /gene="CASP6" /gene_synonym="MCH2" /experiment="experimental evidence, no additional details recorded" /note="proteolytic cleavage site; modified site" /db_xref="HPRD:02799" misc_feature 388..390 /gene="CASP6" /gene_synonym="MCH2" /experiment="experimental evidence, no additional details recorded" /note="proteolytic cleavage site; modified site" /db_xref="HPRD:02799" exon 119..294 /gene="CASP6" /gene_synonym="MCH2" /inference="alignment:Splign:1.39.8" variation 136 /gene="CASP6" /gene_synonym="MCH2" /replace="a" /replace="g" /db_xref="dbSNP:5030674" variation 144 /gene="CASP6" /gene_synonym="MCH2" /replace="c" /replace="t" /db_xref="dbSNP:2227927" variation 216 /gene="CASP6" /gene_synonym="MCH2" /replace="a" /replace="g" /db_xref="dbSNP:3180479" variation 291 /gene="CASP6" /gene_synonym="MCH2" /replace="c" /replace="t" /db_xref="dbSNP:3211296" exon 295..454 /gene="CASP6" /gene_synonym="MCH2" /inference="alignment:Splign:1.39.8" variation 355 /gene="CASP6" /gene_synonym="MCH2" /replace="a" /replace="t" /db_xref="dbSNP:5030593" exon 455..1394 /gene="CASP6" /gene_synonym="MCH2" /inference="alignment:Splign:1.39.8" STS 492..1391 /gene="CASP6" /gene_synonym="MCH2" /standard_name="CASP6_488" /db_xref="UniSTS:277052" variation 715 /gene="CASP6" /gene_synonym="MCH2" /replace="c" /replace="t" /db_xref="dbSNP:1042889" STS 818..950 /gene="CASP6" /gene_synonym="MCH2" /standard_name="D15S1477" /db_xref="UniSTS:474482" STS 832..955 /gene="CASP6" /gene_synonym="MCH2" /standard_name="D11S2560" /db_xref="UniSTS:37928" variation 853 /gene="CASP6" /gene_synonym="MCH2" /replace="c" /replace="t" /db_xref="dbSNP:5030599" variation 978 /gene="CASP6" /gene_synonym="MCH2" /replace="c" /replace="t" /db_xref="dbSNP:5030600" variation 1052 /gene="CASP6" /gene_synonym="MCH2" /replace="c" /replace="t" /db_xref="dbSNP:11770" variation 1066 /gene="CASP6" /gene_synonym="MCH2" /replace="a" /replace="c" /db_xref="dbSNP:5030601" variation 1093 /gene="CASP6" /gene_synonym="MCH2" /replace="c" /replace="t" /db_xref="dbSNP:1042891" variation 1106 /gene="CASP6" /gene_synonym="MCH2" /replace="g" /replace="t" /db_xref="dbSNP:1802755" variation 1127 /gene="CASP6" /gene_synonym="MCH2" /replace="a" /replace="c" /db_xref="dbSNP:199579435" variation 1144..1145 /gene="CASP6" /gene_synonym="MCH2" /replace="a" /replace="t" /db_xref="dbSNP:11574700" variation 1388 /gene="CASP6" /gene_synonym="MCH2" /replace="a" /replace="g" /db_xref="dbSNP:3182325" ORIGIN
ccgagggcggggccgggcccgggagcctgtggcttcaggaagaggagggcaaggtgtctggctgcgcgtttggctgcaatgagctcggcctcggggctccgcagggggcacccggcagtgtcaactgttagccacgcagatgccgattgctttgtgtgtgtcttcctgagccatggcgaaggcaatcacatttatgcatatgatgctaaaatcgaaattcagacattaactggcttgttcaaaggagacaagtgtcacagcctggttggaaaacccaagatatttatcattcaggcatgtcggggaaaccagcacgatgtgccagtcattcctttggatgtagtagataatcagacagagaagttggacaccaacataactgaggtggatgcagcctccgtttacacgctgcctgctggagctgacttcctcatgtgttactctgttgcagaaggatattattctcaccgggaaactgtgaacggctcatggtacattcaagatttgtgtgagatgttgggaaaatatggctcctccttagagttcacagaactcctcacactggtgaacaggaaagtttctcagcgccgagtggacttttgcaaagacccaagtgcaattggaaagaagcaggttccctgttttgcctcaatgctaactaaaaagctgcatttctttccaaaatctaattaattaatagaggctatctaattttacactctgtattgaaaatggctttctcagccaggcgtggttactcacacctgtaatcccagcactttgggagtccaaggtgggcggatcacctgaggtcgggagttcgagaccagcctgaccaacatggagaagccccgtctctactaaaaatgcaaaaaaaaatttagctaggcatggcggcgcatgcctgcaatcccagctacttggaaggctgaggcaggagaatcacttgaacccaggaggtggaggctgcggtgagccgagattgcgccattgcactccagcctgggcaacgagtgaaactccgtctcaaaaaaaagaaaatgtctttctcttccttttatataaatatcgttagggtgaagcattatggtctaatgattcaaatgttttaaagtttaatgcctagcagagaactgccttaaaaaaaaaaaaaaaaagttcatgttggccatggtgaaagggtttgatatggagaaacaaaatcctcaggaaattagataaataaaaatttataagcatttgtattattttttaataaactgcagggttacacaaaaatctagctgatttaacttgtattttgtcacttttttataaaagtttattgtttgatgtttttaaaggtttttgaaatccaggaattaaatcatcccttaataaaatattcgaaattc
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:839 -> Molecular function: GO:0004197 [cysteine-type endopeptidase activity] evidence: TAS GeneID:839 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:839 -> Molecular function: GO:0008234 [cysteine-type peptidase activity] evidence: TAS GeneID:839 -> Biological process: GO:0006508 [proteolysis] evidence: IDA GeneID:839 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS GeneID:839 -> Biological process: GO:0006917 [induction of apoptosis] evidence: TAS GeneID:839 -> Biological process: GO:0006921 [cellular component disassembly involved in execution phase of apoptosis] evidence: TAS GeneID:839 -> Cellular component: GO:0005634 [nucleus] evidence: IDA GeneID:839 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS GeneID:839 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA GeneID:839 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA GeneID:839 -> Cellular component: GO:0005829 [cytosol] evidence: IDA GeneID:839 -> Cellular component: GO:0005829 [cytosol] evidence: TAS ANNOTATIONS from NCBI Entrez Gene (20130726): NP_116787 -> EC 3.4.22.59
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.