Home |
Help |
Advanced search
2024-04-19 19:55:35, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_032989 986 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens BCL2-associated agonist of cell death (BAD),
transcript variant 2, mRNA.
ACCESSION NM_032989
VERSION NM_032989.2 GI:197116382
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 986)
AUTHORS Tran,A.T., Cortens,J.P., Du,Q., Wilkins,J.A. and Coombs,K.M.
TITLE Influenza virus induces apoptosis via BAD-mediated mitochondrial
dysregulation
JOURNAL J. Virol. 87 (2), 1049-1060 (2013)
PUBMED 23135712
REMARK GeneRIF: These data indicate that influenza viruses carefully
modulate the activation of the apoptotic pathway that is dependent
on the regulatory function of BAD and that failure of apoptosis
activation resulted in unproductive viral replication.
REFERENCE 2 (bases 1 to 986)
AUTHORS Fischer,A., Schmid,B., Ellinghaus,D., Nothnagel,M., Gaede,K.I.,
Schurmann,M., Lipinski,S., Rosenstiel,P., Zissel,G., Hohne,K.,
Petrek,M., Kolek,V., Pabst,S., Grohe,C., Grunewald,J.,
Ronninger,M., Eklund,A., Padyukov,L., Gieger,C., Wichmann,H.E.,
Nebel,A., Franke,A., Muller-Quernheim,J., Hofmann,S. and
Schreiber,S.
TITLE A novel sarcoidosis risk locus for Europeans on chromosome 11q13.1
JOURNAL Am. J. Respir. Crit. Care Med. 186 (9), 877-885 (2012)
PUBMED 22837380
REFERENCE 3 (bases 1 to 986)
AUTHORS Zimmerman,M.A., Rahman,N.T., Yang,D., Lahat,G., Lazar,A.J.,
Pollock,R.E., Lev,D. and Liu,K.
TITLE Unphosphorylated STAT1 promotes sarcoma development through
repressing expression of Fas and bad and conferring apoptotic
resistance
JOURNAL Cancer Res. 72 (18), 4724-4732 (2012)
PUBMED 22805310
REMARK GeneRIF: RNAi-mediated silencing of STAT1 in soft tissue sarcoma
(STS) cells was sufficient to increase expression of the apoptotic
mediators Fas and Bad and to elevate the sensitivity of STS cells
to Fas-mediated apoptosis
REFERENCE 4 (bases 1 to 986)
AUTHORS Aranovich,A., Liu,Q., Collins,T., Geng,F., Dixit,S., Leber,B. and
Andrews,D.W.
TITLE Differences in the mechanisms of proapoptotic BH3 proteins binding
to Bcl-XL and Bcl-2 quantified in live MCF-7 cells
JOURNAL Mol. Cell 45 (6), 754-763 (2012)
PUBMED 22464442
REMARK GeneRIF: mechanism of proapoptotic BH3 proteins Bad and Bid binding
to Bcl-XL and Bcl-2 in breast cancer cells
REFERENCE 5 (bases 1 to 986)
AUTHORS Qayyum,R., Snively,B.M., Ziv,E., Nalls,M.A., Liu,Y., Tang,W.,
Yanek,L.R., Lange,L., Evans,M.K., Ganesh,S., Austin,M.A.,
Lettre,G., Becker,D.M., Zonderman,A.B., Singleton,A.B.,
Harris,T.B., Mohler,E.R., Logsdon,B.A., Kooperberg,C., Folsom,A.R.,
Wilson,J.G., Becker,L.C. and Reiner,A.P.
TITLE A meta-analysis and genome-wide association study of platelet count
and mean platelet volume in african americans
JOURNAL PLoS Genet. 8 (3), E1002491 (2012)
PUBMED 22423221
REFERENCE 6 (bases 1 to 986)
AUTHORS Hsu,S.Y., Kaipia,A., Zhu,L. and Hsueh,A.J.
TITLE Interference of BAD (Bcl-xL/Bcl-2-associated death
promoter)-induced apoptosis in mammalian cells by 14-3-3 isoforms
and P11
JOURNAL Mol. Endocrinol. 11 (12), 1858-1867 (1997)
PUBMED 9369453
REFERENCE 7 (bases 1 to 986)
AUTHORS Zha,J., Harada,H., Osipov,K., Jockel,J., Waksman,G. and
Korsmeyer,S.J.
TITLE BH3 domain of BAD is required for heterodimerization with BCL-XL
and pro-apoptotic activity
JOURNAL J. Biol. Chem. 272 (39), 24101-24104 (1997)
PUBMED 9305851
REFERENCE 8 (bases 1 to 986)
AUTHORS Wang,H.G., Rapp,U.R. and Reed,J.C.
TITLE Bcl-2 targets the protein kinase Raf-1 to mitochondria
JOURNAL Cell 87 (4), 629-638 (1996)
PUBMED 8929532
REFERENCE 9 (bases 1 to 986)
AUTHORS Zha,J., Harada,H., Yang,E., Jockel,J. and Korsmeyer,S.J.
TITLE Serine phosphorylation of death agonist BAD in response to survival
factor results in binding to 14-3-3 not BCL-X(L)
JOURNAL Cell 87 (4), 619-628 (1996)
PUBMED 8929531
REFERENCE 10 (bases 1 to 986)
AUTHORS Yang,E., Zha,J., Jockel,J., Boise,L.H., Thompson,C.B. and
Korsmeyer,S.J.
TITLE Bad, a heterodimeric partner for Bcl-XL and Bcl-2, displaces Bax
and promotes cell death
JOURNAL Cell 80 (2), 285-291 (1995)
PUBMED 7834748
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AK291863.1 and AW014069.1.
On Aug 21, 2008 this sequence version replaced gi:14670387.
Summary: The protein encoded by this gene is a member of the BCL-2
family. BCL-2 family members are known to be regulators of
programmed cell death. This protein positively regulates cell
apoptosis by forming heterodimers with BCL-xL and BCL-2, and
reversing their death repressor activity. Proapoptotic activity of
this protein is regulated through its phosphorylation. Protein
kinases AKT and MAP kinase, as well as protein phosphatase
calcineurin were found to be involved in the regulation of this
protein. Alternative splicing of this gene results in two
transcript variants which encode the same isoform. [provided by
RefSeq, Jul 2008].
Transcript Variant: This variant (2) differs in the 5' UTR compared
to variant 1. Variants 1 and 2 both encode the same protein.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AK291863.1, BC095431.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025098 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-952 AK291863.1 1-952
953-986 AW014069.1 1-34 c
FEATURES Location/Qualifiers
source 1..986
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="11"
/map="11q13.1"
gene 1..986
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/note="BCL2-associated agonist of cell death"
/db_xref="GeneID:572"
/db_xref="HGNC:936"
/db_xref="MIM:603167"
exon 1..74
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/inference="alignment:Splign:1.39.8"
exon 75..269
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/inference="alignment:Splign:1.39.8"
CDS 83..589
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/note="BCL2-binding protein; BCL2-binding component 6;
BCL-X/BCL-2 binding protein; BCL2-antagonist of cell death
protein; bcl2-L-8; bcl-2-like protein 8; bcl-2-binding
component 6; bcl-XL/Bcl-2-associated death promoter"
/codon_start=1
/product="bcl2 antagonist of cell death"
/protein_id="NP_116784.1"
/db_xref="GI:14670388"
/db_xref="CCDS:CCDS8065.1"
/db_xref="GeneID:572"
/db_xref="HGNC:936"
/db_xref="MIM:603167"
/translation="
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
"
misc_feature 83..586
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/note="Pro-apoptotic Bcl-2 protein, BAD; Region:
Bcl-2_BAD; pfam10514"
/db_xref="CDD:119034"
misc_feature 305..307
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:03402"
misc_feature 305..307
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:03403"
misc_feature 305..307
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:06423"
misc_feature 305..307
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:01261"
misc_feature 305..307
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:01292"
misc_feature 305..307
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:02244"
misc_feature 305..307
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:15137"
misc_feature 353..355
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q92934.3); phosphorylation site"
misc_feature 362..364
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="Asymmetric dimethylarginine, by PRMT1; propagated
from UniProtKB/Swiss-Prot (Q92934.3); methylation site"
misc_feature 368..370
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="Asymmetric dimethylarginine, by PRMT1; propagated
from UniProtKB/Swiss-Prot (Q92934.3); methylation site"
misc_feature 377..379
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by PKB/AKT1, alternate; propagated
from UniProtKB/Swiss-Prot (Q92934.3); phosphorylation
site"
misc_feature 377..379
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:01261"
misc_feature 377..379
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:01292"
misc_feature 377..379
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:02244"
misc_feature 377..379
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:15137"
misc_feature 410..454
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q92934.3);
Region: BH3"
misc_feature 434..436
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q92934.3); phosphorylation site"
misc_feature 434..436
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:03382"
misc_feature 434..436
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:03402"
misc_feature 434..436
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:03403"
misc_feature 434..436
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:01261"
misc_feature 434..436
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:01292"
misc_feature 434..436
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:02244"
misc_feature 434..436
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:15137"
misc_feature 434..436
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:03995"
misc_feature 482..484
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 482..484
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:03995"
misc_feature 539..541
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:03382"
misc_feature 539..541
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:03402"
misc_feature 539..541
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
variation 224
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/replace="g"
/replace="t"
/db_xref="dbSNP:11541683"
exon 270..460
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/inference="alignment:Splign:1.39.8"
variation 370
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/replace="c"
/replace="t"
/db_xref="dbSNP:2286615"
variation 401
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/replace="g"
/replace="t"
/db_xref="dbSNP:3729933"
variation 409
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:2286616"
exon 461..970
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/inference="alignment:Splign:1.39.8"
STS 461..721
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/standard_name="PMC230316P4"
/db_xref="UniSTS:272182"
variation 534
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/replace="c"
/replace="t"
/db_xref="dbSNP:15934"
STS 581..714
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/standard_name="RH78541"
/db_xref="UniSTS:66632"
STS 596..786
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/standard_name="RH80230"
/db_xref="UniSTS:87698"
STS 694..880
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/standard_name="SHGC-64070"
/db_xref="UniSTS:76204"
STS 697..944
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/standard_name="RH80521"
/db_xref="UniSTS:83919"
variation 859
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/replace="c"
/replace="t"
/db_xref="dbSNP:1050029"
variation 863
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
/replace="a"
/replace="g"
/db_xref="dbSNP:10556"
polyA_signal 945..950
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
polyA_site 970
/gene="BAD"
/gene_synonym="BBC2; BCL2L8"
ORIGIN
aactagggcccggagcccggggtgctggagggaggcggcaggcccgggtcaggggcctcgagatcgggcttgggcccagagcatgttccagatcccagagtttgagccgagtgagcaggaagactccagctctgcagagaggggcctgggccccagccccgcaggggacgggccctcaggctccggcaagcatcatcgccaggccccaggcctcctgtgggacgccagtcaccagcaggagcagccaaccagcagcagccatcatggaggcgctggggctgtggagatccggagtcgccacagctcctaccccgcggggacggaggacgacgaagggatgggggaggagcccagcccctttcggggccgctcgcgctcggcgccccccaacctctgggcagcacagcgctatggccgcgagctccggaggatgagtgacgagtttgtggactcctttaagaagggacttcctcgcccgaagagcgcgggcacagcaacgcagatgcggcaaagctccagctggacgcgagtcttccagtcctggtgggatcggaacttgggcaggggaagctccgccccctcccagtgaccttcgctccacatcccgaaactccacccgttcccactgccctgggcagccatcttgaatatgggcggaagtacttccctcaggcctatgcaaaaagaggatccgtgctgtctcctttggagggagggctgacccagattcccttccggtgcgtgtgaagccacggaaggcttggtcccatcggaagttttgggttttccgcccacagccgccggaagtggctccgtggccccgccctcaggctccgggctttcccccaggcgcctgcgctaagtcgcgagccaggtttaaccgttgcgtcaccgggacccgagcccccgcgatgccctgggggccgtgctcactaccaaatgttaataaagcccgcgtctgtgccgccgaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:572 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:572 -> Molecular function: GO:0005543 [phospholipid binding] evidence: IMP
GeneID:572 -> Molecular function: GO:0008289 [lipid binding] evidence: IDA
GeneID:572 -> Molecular function: GO:0008656 [cysteine-type endopeptidase activator activity involved in apoptotic process] evidence: IDA
GeneID:572 -> Molecular function: GO:0019901 [protein kinase binding] evidence: IPI
GeneID:572 -> Molecular function: GO:0030346 [protein phosphatase 2B binding] evidence: IEA
GeneID:572 -> Molecular function: GO:0043422 [protein kinase B binding] evidence: IEA
GeneID:572 -> Molecular function: GO:0046982 [protein heterodimerization activity] evidence: IEA
GeneID:572 -> Biological process: GO:0006007 [glucose catabolic process] evidence: IEA
GeneID:572 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:572 -> Biological process: GO:0006917 [induction of apoptosis] evidence: IDA
GeneID:572 -> Biological process: GO:0006919 [activation of cysteine-type endopeptidase activity involved in apoptotic process] evidence: ISS
GeneID:572 -> Biological process: GO:0007173 [epidermal growth factor receptor signaling pathway] evidence: TAS
GeneID:572 -> Biological process: GO:0008543 [fibroblast growth factor receptor signaling pathway] evidence: TAS
GeneID:572 -> Biological process: GO:0009749 [response to glucose stimulus] evidence: IEA
GeneID:572 -> Biological process: GO:0010508 [positive regulation of autophagy] evidence: TAS
GeneID:572 -> Biological process: GO:0010918 [positive regulation of mitochondrial membrane potential] evidence: ISS
GeneID:572 -> Biological process: GO:0019221 [cytokine-mediated signaling pathway] evidence: IEA
GeneID:572 -> Biological process: GO:0032024 [positive regulation of insulin secretion] evidence: ISS
GeneID:572 -> Biological process: GO:0032355 [response to estradiol stimulus] evidence: IEA
GeneID:572 -> Biological process: GO:0032570 [response to progesterone stimulus] evidence: IEA
GeneID:572 -> Biological process: GO:0033133 [positive regulation of glucokinase activity] evidence: ISS
GeneID:572 -> Biological process: GO:0033574 [response to testosterone stimulus] evidence: IEA
GeneID:572 -> Biological process: GO:0034201 [response to oleic acid] evidence: IEA
GeneID:572 -> Biological process: GO:0035774 [positive regulation of insulin secretion involved in cellular response to glucose stimulus] evidence: IEA
GeneID:572 -> Biological process: GO:0038095 [Fc-epsilon receptor signaling pathway] evidence: TAS
GeneID:572 -> Biological process: GO:0042493 [response to drug] evidence: IEA
GeneID:572 -> Biological process: GO:0042542 [response to hydrogen peroxide] evidence: IEA
GeneID:572 -> Biological process: GO:0042593 [glucose homeostasis] evidence: ISS
GeneID:572 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: IDA
GeneID:572 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: IMP
GeneID:572 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: TAS
GeneID:572 -> Biological process: GO:0043200 [response to amino acid stimulus] evidence: IEA
GeneID:572 -> Biological process: GO:0043280 [positive regulation of cysteine-type endopeptidase activity involved in apoptotic process] evidence: IDA
GeneID:572 -> Biological process: GO:0044342 [type B pancreatic cell proliferation] evidence: ISS
GeneID:572 -> Biological process: GO:0045087 [innate immune response] evidence: TAS
GeneID:572 -> Biological process: GO:0045471 [response to ethanol] evidence: IEA
GeneID:572 -> Biological process: GO:0045579 [positive regulation of B cell differentiation] evidence: IEA
GeneID:572 -> Biological process: GO:0045582 [positive regulation of T cell differentiation] evidence: IEA
GeneID:572 -> Biological process: GO:0045862 [positive regulation of proteolysis] evidence: IDA
GeneID:572 -> Biological process: GO:0046031 [ADP metabolic process] evidence: ISS
GeneID:572 -> Biological process: GO:0046034 [ATP metabolic process] evidence: ISS
GeneID:572 -> Biological process: GO:0046902 [regulation of mitochondrial membrane permeability] evidence: IMP
GeneID:572 -> Biological process: GO:0046931 [pore complex assembly] evidence: IDA
GeneID:572 -> Biological process: GO:0048011 [neurotrophin TRK receptor signaling pathway] evidence: TAS
GeneID:572 -> Biological process: GO:0048015 [phosphatidylinositol-mediated signaling] evidence: TAS
GeneID:572 -> Biological process: GO:0050679 [positive regulation of epithelial cell proliferation] evidence: IMP
GeneID:572 -> Biological process: GO:0051384 [response to glucocorticoid stimulus] evidence: IEA
GeneID:572 -> Biological process: GO:0051592 [response to calcium ion] evidence: IEA
GeneID:572 -> Biological process: GO:0060154 [cellular process regulating host cell cycle in response to virus] evidence: IEA
GeneID:572 -> Biological process: GO:0071247 [cellular response to chromate] evidence: IEA
GeneID:572 -> Biological process: GO:0071260 [cellular response to mechanical stimulus] evidence: IEP
GeneID:572 -> Biological process: GO:0071316 [cellular response to nicotine] evidence: IDA
GeneID:572 -> Biological process: GO:0071396 [cellular response to lipid] evidence: IEA
GeneID:572 -> Biological process: GO:0071456 [cellular response to hypoxia] evidence: IEP
GeneID:572 -> Biological process: GO:0090200 [positive regulation of release of cytochrome c from mitochondria] evidence: IMP
GeneID:572 -> Biological process: GO:0097190 [apoptotic signaling pathway] evidence: TAS
GeneID:572 -> Biological process: GO:0097191 [extrinsic apoptotic signaling pathway] evidence: IMP
GeneID:572 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: IMP
GeneID:572 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: TAS
GeneID:572 -> Biological process: GO:0097202 [activation of cysteine-type endopeptidase activity] evidence: IDA
GeneID:572 -> Biological process: GO:1900740 [positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway] evidence: TAS
GeneID:572 -> Biological process: GO:2000078 [positive regulation of type B pancreatic cell development] evidence: ISS
GeneID:572 -> Biological process: GO:2001244 [positive regulation of intrinsic apoptotic signaling pathway] evidence: TAS
GeneID:572 -> Cellular component: GO:0005739 [mitochondrion] evidence: IDA
GeneID:572 -> Cellular component: GO:0005741 [mitochondrial outer membrane] evidence: IDA
GeneID:572 -> Cellular component: GO:0005741 [mitochondrial outer membrane] evidence: TAS
GeneID:572 -> Cellular component: GO:0005829 [cytosol] evidence: IDA
GeneID:572 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.