GGRNA Home | Help | Advanced search

2024-03-29 20:20:15, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_032339                781 bp    mRNA    linear   PRI 24-JUN-2013
DEFINITION  Homo sapiens migration and invasion enhancer 1 (MIEN1), mRNA.
ACCESSION   NM_032339
VERSION     NM_032339.3  GI:42822890
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 781)
  AUTHORS   Hsu,C.H., Shen,T.L., Chang,C.F., Chang,Y.Y. and Huang,L.Y.
  TITLE     Solution structure of the oncogenic MIEN1 protein reveals a
            thioredoxin-like fold with a redox-active motif
  JOURNAL   PLoS ONE 7 (12), E52292 (2012)
   PUBMED   23284973
  REMARK    GeneRIF: Results suggest that MIEN1 may have an important
            regulatory role in phosphorylation of AKT with its redox potential.
REFERENCE   2  (bases 1 to 781)
  AUTHORS   Dasgupta,S., Cushman,I., Kpetemey,M., Casey,P.J. and
            Vishwanatha,J.K.
  TITLE     Prenylated c17orf37 induces filopodia formation to promote cell
            migration and metastasis
  JOURNAL   J. Biol. Chem. 286 (29), 25935-25946 (2011)
   PUBMED   21628459
  REMARK    GeneRIF: prenylation is required for the function of the C17orf37
            protein in cancer cells
REFERENCE   3  (bases 1 to 781)
  AUTHORS   Katz,E., Verleyen,W., Blackmore,C.G., Edward,M., Smith,V.A. and
            Harrison,D.J.
  TITLE     An analytical approach differentiates between individual and
            collective cancer invasion
  JOURNAL   Anal Cell Pathol (Amst) 34 (1-2), 35-48 (2011)
   PUBMED   21483102
REFERENCE   4  (bases 1 to 781)
  AUTHORS   Katz,E., Dubois-Marshall,S., Sims,A.H., Gautier,P., Caldwell,H.,
            Meehan,R.R. and Harrison,D.J.
  TITLE     An in vitro model that recapitulates the epithelial to mesenchymal
            transition (EMT) in human breast cancer
  JOURNAL   PLoS ONE 6 (2), E17083 (2011)
   PUBMED   21347235
  REMARK    Erratum:[PLoS One. 2011;6(4). doi:
            10.1371/annotation/b9ee2908-d86b-4e21-86b7-4d0151ad538a]
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 781)
  AUTHORS   Liu,Q.Q., Yin,K., Zhu,S., Zhang,L., Wen,P.E., Li,C.L., Zhang,D.B.,
            Liu,M. and Yan,G.
  TITLE     Inhibition of C35 gene expression by small interfering RNA induces
            apoptosis of breast cancer cells
  JOURNAL   Biosci Trends 4 (5), 254-259 (2010)
   PUBMED   21068479
  REMARK    GeneRIF: Inhibition of C35 gene expression by small interfering RNA
            induces apoptosis of breast cancer cells.
REFERENCE   6  (bases 1 to 781)
  AUTHORS   Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z.,
            Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S.,
            McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J.,
            Dunham,I., Hill,D.E. and Vidal,M.
  TITLE     hORFeome v3.1: a resource of human open reading frames representing
            over 10,000 human genes
  JOURNAL   Genomics 89 (3), 307-315 (2007)
   PUBMED   17207965
REFERENCE   7  (bases 1 to 781)
  AUTHORS   Benusiglio,P.R., Pharoah,P.D., Smith,P.L., Lesueur,F., Conroy,D.,
            Luben,R.N., Dew,G., Jordan,C., Dunning,A., Easton,D.F. and
            Ponder,B.A.
  TITLE     HapMap-based study of the 17q21 ERBB2 amplicon in susceptibility to
            breast cancer
  JOURNAL   Br. J. Cancer 95 (12), 1689-1695 (2006)
   PUBMED   17117180
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   8  (bases 1 to 781)
  AUTHORS   Evans,E.E., Henn,A.D., Jonason,A., Paris,M.J., Schiffhauer,L.M.,
            Borrello,M.A., Smith,E.S., Sahasrabudhe,D.M. and Zauderer,M.
  TITLE     C35 (C17orf37) is a novel tumor biomarker abundantly expressed in
            breast cancer
  JOURNAL   Mol. Cancer Ther. 5 (11), 2919-2930 (2006)
   PUBMED   17121940
REFERENCE   9  (bases 1 to 781)
  AUTHORS   Katoh,M. and Katoh,M.
  TITLE     Evolutionary recombination hotspot around GSDML-GSDM locus is
            closely linked to the oncogenomic recombination hotspot around the
            PPP1R1B-ERBB2-GRB7 amplicon
  JOURNAL   Int. J. Oncol. 24 (4), 757-763 (2004)
   PUBMED   15010812
  REMARK    GeneRIF: Oncogenomic recombination hotspot around the
            PPP1R1B-STARD3-TCAP-PNMT-PERLD1-ERBB2-C17orf37-GRB7 amplicon at
            human chromosome 17q12 is closely linked to evolutionary
            recombination hotspot around the GSDML-GSDM locus.
REFERENCE   10 (bases 1 to 781)
  AUTHORS   Katoh,M. and Katoh,M.
  TITLE     MGC9753 gene, located within PPP1R1B-STARD3-ERBB2-GRB7 amplicon on
            human chromosome 17q12, encodes the seven-transmembrane receptor
            with extracellular six-cystein domain
  JOURNAL   Int. J. Oncol. 22 (6), 1369-1374 (2003)
   PUBMED   12739007
  REMARK    GeneRIF: MGC14832 gene is located within human chromosome 17q12
            amplicon, including PPP1R1B, STARD3, TCAP, PNMT, ERBB2, MGC14832
            and GRB7 genes.  PPP1R1B ~ ERBB2 ~ GRB7 locus is amplified in human
            gastric cancer and breast cancer.
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BX646129.1 and BC006006.1.
            On Feb 26, 2004 this sequence version replaced gi:40217783.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC006006.1, BI831153.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025098 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-33                BX646129.1         2-34
            34-781              BC006006.1         1-748
FEATURES             Location/Qualifiers
     source          1..781
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="17"
                     /map="17q12"
     gene            1..781
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /note="migration and invasion enhancer 1"
                     /db_xref="GeneID:84299"
                     /db_xref="HGNC:28230"
                     /db_xref="HPRD:12681"
                     /db_xref="MIM:611802"
     exon            1..129
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(9)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373060226"
     variation       complement(19)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:369407025"
     variation       complement(37)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201802003"
     CDS             41..388
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /note="protein C17orf37; HBV XAg-transactivated protein 4;
                     HBV X-transactivated gene 4 protein"
                     /codon_start=1
                     /product="migration and invasion enhancer 1"
                     /protein_id="NP_115715.3"
                     /db_xref="GI:42822891"
                     /db_xref="CCDS:CCDS11344.1"
                     /db_xref="GeneID:84299"
                     /db_xref="HGNC:28230"
                     /db_xref="HPRD:12681"
                     /db_xref="MIM:611802"
                     /translation="
MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL
"
     mat_peptide     41..376
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /product="Migration and invasion enhancer 1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9BRT3.1)"
     misc_feature    107..328
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /note="Rdx family; Region: Rdx; pfam10262"
                     /db_xref="CDD:204425"
     variation       complement(60)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373949353"
     exon            130..227
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(171)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:150225861"
     variation       complement(193)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140980514"
     variation       complement(205)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368781173"
     variation       complement(222)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200527214"
     exon            228..304
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(280)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147035036"
     exon            305..754
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(337)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113655366"
     variation       complement(365)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:367609706"
     variation       complement(377)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373770547"
     variation       complement(403)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200858505"
     variation       complement(414)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370967916"
     variation       complement(421)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185534269"
     variation       complement(435)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373612379"
     variation       complement(521..522)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:4252667"
     variation       complement(522..523)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:34503675"
     variation       complement(523)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74845995"
     variation       complement(525)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:77052876"
     variation       complement(563)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:56343992"
     STS             566..703
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /standard_name="D17S2147"
                     /db_xref="UniSTS:15350"
     variation       complement(605)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139936417"
     variation       complement(631)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150695808"
     variation       complement(635)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142997827"
     variation       complement(636)
                     /gene="MIEN1"
                     /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4252666"
ORIGIN      
gtcacacccggaagcaggggcccgagcggagccggccgcgatgagcggggagccggggcagacgtccgtagcgccccctcccgaggaggtcgagccgggcagtggggtccgcatcgtggtggagtactgtgaaccctgcggcttcgaggcgacctacctggagctggccagtgctgtgaaggagcagtatccgggcatcgagatcgagtcgcgcctcgggggcacaggtgcctttgagatagagataaatggacagctggtgttctccaagctggagaatgggggctttccctatgagaaagatctcattgaggccatccgaagagccagtaatggagaaaccctagaaaagatcaccaacagccgtcctccctgcgtcatcctgtgactgcacaggactctgggttcctgctctgttctggggtccaaaccttggtctccctttggtcctgctgggagctccccctgcctctttcccctacttagctccttagcaaagagaccctggcctccactttgccctttgggtacaaagaaggaatagaagattccgtggccttgggggcaggagagagacactctccatgaacacttctccagccacctcatacccccttcccagggtaagtgcccacgaaagcccagtccactcttcgcctcggtaatacctgtctgatgccacagattttatttattctcccctaacccagggcaatgtcagctattggcagtaaagtggcgctacaaacactaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:84299 -> Molecular function: GO:0008430 [selenium binding] evidence: IEA
            GeneID:84299 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
            GeneID:84299 -> Biological process: GO:0030335 [positive regulation of cell migration] evidence: IDA
            GeneID:84299 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IDA
            GeneID:84299 -> Biological process: GO:0045454 [cell redox homeostasis] evidence: IEA
            GeneID:84299 -> Biological process: GO:0051491 [positive regulation of filopodium assembly] evidence: IDA
            GeneID:84299 -> Cellular component: GO:0005829 [cytosol] evidence: IDA
            GeneID:84299 -> Cellular component: GO:0031235 [intrinsic to internal side of plasma membrane] evidence: IDA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.