2024-03-29 20:20:15, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_032339 781 bp mRNA linear PRI 24-JUN-2013 DEFINITION Homo sapiens migration and invasion enhancer 1 (MIEN1), mRNA. ACCESSION NM_032339 VERSION NM_032339.3 GI:42822890 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 781) AUTHORS Hsu,C.H., Shen,T.L., Chang,C.F., Chang,Y.Y. and Huang,L.Y. TITLE Solution structure of the oncogenic MIEN1 protein reveals a thioredoxin-like fold with a redox-active motif JOURNAL PLoS ONE 7 (12), E52292 (2012) PUBMED 23284973 REMARK GeneRIF: Results suggest that MIEN1 may have an important regulatory role in phosphorylation of AKT with its redox potential. REFERENCE 2 (bases 1 to 781) AUTHORS Dasgupta,S., Cushman,I., Kpetemey,M., Casey,P.J. and Vishwanatha,J.K. TITLE Prenylated c17orf37 induces filopodia formation to promote cell migration and metastasis JOURNAL J. Biol. Chem. 286 (29), 25935-25946 (2011) PUBMED 21628459 REMARK GeneRIF: prenylation is required for the function of the C17orf37 protein in cancer cells REFERENCE 3 (bases 1 to 781) AUTHORS Katz,E., Verleyen,W., Blackmore,C.G., Edward,M., Smith,V.A. and Harrison,D.J. TITLE An analytical approach differentiates between individual and collective cancer invasion JOURNAL Anal Cell Pathol (Amst) 34 (1-2), 35-48 (2011) PUBMED 21483102 REFERENCE 4 (bases 1 to 781) AUTHORS Katz,E., Dubois-Marshall,S., Sims,A.H., Gautier,P., Caldwell,H., Meehan,R.R. and Harrison,D.J. TITLE An in vitro model that recapitulates the epithelial to mesenchymal transition (EMT) in human breast cancer JOURNAL PLoS ONE 6 (2), E17083 (2011) PUBMED 21347235 REMARK Erratum:[PLoS One. 2011;6(4). doi: 10.1371/annotation/b9ee2908-d86b-4e21-86b7-4d0151ad538a] Publication Status: Online-Only REFERENCE 5 (bases 1 to 781) AUTHORS Liu,Q.Q., Yin,K., Zhu,S., Zhang,L., Wen,P.E., Li,C.L., Zhang,D.B., Liu,M. and Yan,G. TITLE Inhibition of C35 gene expression by small interfering RNA induces apoptosis of breast cancer cells JOURNAL Biosci Trends 4 (5), 254-259 (2010) PUBMED 21068479 REMARK GeneRIF: Inhibition of C35 gene expression by small interfering RNA induces apoptosis of breast cancer cells. REFERENCE 6 (bases 1 to 781) AUTHORS Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z., Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S., McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J., Dunham,I., Hill,D.E. and Vidal,M. TITLE hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes JOURNAL Genomics 89 (3), 307-315 (2007) PUBMED 17207965 REFERENCE 7 (bases 1 to 781) AUTHORS Benusiglio,P.R., Pharoah,P.D., Smith,P.L., Lesueur,F., Conroy,D., Luben,R.N., Dew,G., Jordan,C., Dunning,A., Easton,D.F. and Ponder,B.A. TITLE HapMap-based study of the 17q21 ERBB2 amplicon in susceptibility to breast cancer JOURNAL Br. J. Cancer 95 (12), 1689-1695 (2006) PUBMED 17117180 REMARK GeneRIF: Observational study of gene-disease association. (HuGE Navigator) REFERENCE 8 (bases 1 to 781) AUTHORS Evans,E.E., Henn,A.D., Jonason,A., Paris,M.J., Schiffhauer,L.M., Borrello,M.A., Smith,E.S., Sahasrabudhe,D.M. and Zauderer,M. TITLE C35 (C17orf37) is a novel tumor biomarker abundantly expressed in breast cancer JOURNAL Mol. Cancer Ther. 5 (11), 2919-2930 (2006) PUBMED 17121940 REFERENCE 9 (bases 1 to 781) AUTHORS Katoh,M. and Katoh,M. TITLE Evolutionary recombination hotspot around GSDML-GSDM locus is closely linked to the oncogenomic recombination hotspot around the PPP1R1B-ERBB2-GRB7 amplicon JOURNAL Int. J. Oncol. 24 (4), 757-763 (2004) PUBMED 15010812 REMARK GeneRIF: Oncogenomic recombination hotspot around the PPP1R1B-STARD3-TCAP-PNMT-PERLD1-ERBB2-C17orf37-GRB7 amplicon at human chromosome 17q12 is closely linked to evolutionary recombination hotspot around the GSDML-GSDM locus. REFERENCE 10 (bases 1 to 781) AUTHORS Katoh,M. and Katoh,M. TITLE MGC9753 gene, located within PPP1R1B-STARD3-ERBB2-GRB7 amplicon on human chromosome 17q12, encodes the seven-transmembrane receptor with extracellular six-cystein domain JOURNAL Int. J. Oncol. 22 (6), 1369-1374 (2003) PUBMED 12739007 REMARK GeneRIF: MGC14832 gene is located within human chromosome 17q12 amplicon, including PPP1R1B, STARD3, TCAP, PNMT, ERBB2, MGC14832 and GRB7 genes. PPP1R1B ~ ERBB2 ~ GRB7 locus is amplified in human gastric cancer and breast cancer. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BX646129.1 and BC006006.1. On Feb 26, 2004 this sequence version replaced gi:40217783. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC006006.1, BI831153.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025098 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-33 BX646129.1 2-34 34-781 BC006006.1 1-748 FEATURES Location/Qualifiers source 1..781 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="17" /map="17q12" gene 1..781 /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /note="migration and invasion enhancer 1" /db_xref="GeneID:84299" /db_xref="HGNC:28230" /db_xref="HPRD:12681" /db_xref="MIM:611802" exon 1..129 /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /inference="alignment:Splign:1.39.8" variation complement(9) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="c" /replace="t" /db_xref="dbSNP:373060226" variation complement(19) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="g" /replace="t" /db_xref="dbSNP:369407025" variation complement(37) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="a" /replace="c" /db_xref="dbSNP:201802003" CDS 41..388 /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /note="protein C17orf37; HBV XAg-transactivated protein 4; HBV X-transactivated gene 4 protein" /codon_start=1 /product="migration and invasion enhancer 1" /protein_id="NP_115715.3" /db_xref="GI:42822891" /db_xref="CCDS:CCDS11344.1" /db_xref="GeneID:84299" /db_xref="HGNC:28230" /db_xref="HPRD:12681" /db_xref="MIM:611802" /translation="
MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL
" mat_peptide 41..376 /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /product="Migration and invasion enhancer 1" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q9BRT3.1)" misc_feature 107..328 /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /note="Rdx family; Region: Rdx; pfam10262" /db_xref="CDD:204425" variation complement(60) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="a" /replace="g" /db_xref="dbSNP:373949353" exon 130..227 /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /inference="alignment:Splign:1.39.8" variation complement(171) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="c" /replace="g" /db_xref="dbSNP:150225861" variation complement(193) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="a" /replace="g" /db_xref="dbSNP:140980514" variation complement(205) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="c" /replace="t" /db_xref="dbSNP:368781173" variation complement(222) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="a" /replace="g" /db_xref="dbSNP:200527214" exon 228..304 /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /inference="alignment:Splign:1.39.8" variation complement(280) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="c" /replace="t" /db_xref="dbSNP:147035036" exon 305..754 /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /inference="alignment:Splign:1.39.8" variation complement(337) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="a" /replace="g" /db_xref="dbSNP:113655366" variation complement(365) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="c" /replace="g" /db_xref="dbSNP:367609706" variation complement(377) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="a" /replace="g" /db_xref="dbSNP:373770547" variation complement(403) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="c" /replace="g" /db_xref="dbSNP:200858505" variation complement(414) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="c" /replace="g" /db_xref="dbSNP:370967916" variation complement(421) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="a" /replace="g" /db_xref="dbSNP:185534269" variation complement(435) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="c" /replace="g" /db_xref="dbSNP:373612379" variation complement(521..522) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="" /replace="c" /db_xref="dbSNP:4252667" variation complement(522..523) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="" /replace="c" /db_xref="dbSNP:34503675" variation complement(523) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="c" /replace="t" /db_xref="dbSNP:74845995" variation complement(525) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="c" /replace="t" /db_xref="dbSNP:77052876" variation complement(563) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="g" /replace="t" /db_xref="dbSNP:56343992" STS 566..703 /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /standard_name="D17S2147" /db_xref="UniSTS:15350" variation complement(605) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="c" /replace="t" /db_xref="dbSNP:139936417" variation complement(631) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="c" /replace="t" /db_xref="dbSNP:150695808" variation complement(635) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="c" /replace="t" /db_xref="dbSNP:142997827" variation complement(636) /gene="MIEN1" /gene_synonym="C17orf37; C35; ORB3; RDX12; XTP4" /replace="a" /replace="g" /db_xref="dbSNP:4252666" ORIGIN
gtcacacccggaagcaggggcccgagcggagccggccgcgatgagcggggagccggggcagacgtccgtagcgccccctcccgaggaggtcgagccgggcagtggggtccgcatcgtggtggagtactgtgaaccctgcggcttcgaggcgacctacctggagctggccagtgctgtgaaggagcagtatccgggcatcgagatcgagtcgcgcctcgggggcacaggtgcctttgagatagagataaatggacagctggtgttctccaagctggagaatgggggctttccctatgagaaagatctcattgaggccatccgaagagccagtaatggagaaaccctagaaaagatcaccaacagccgtcctccctgcgtcatcctgtgactgcacaggactctgggttcctgctctgttctggggtccaaaccttggtctccctttggtcctgctgggagctccccctgcctctttcccctacttagctccttagcaaagagaccctggcctccactttgccctttgggtacaaagaaggaatagaagattccgtggccttgggggcaggagagagacactctccatgaacacttctccagccacctcatacccccttcccagggtaagtgcccacgaaagcccagtccactcttcgcctcggtaatacctgtctgatgccacagattttatttattctcccctaacccagggcaatgtcagctattggcagtaaagtggcgctacaaacactaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:84299 -> Molecular function: GO:0008430 [selenium binding] evidence: IEA GeneID:84299 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA GeneID:84299 -> Biological process: GO:0030335 [positive regulation of cell migration] evidence: IDA GeneID:84299 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IDA GeneID:84299 -> Biological process: GO:0045454 [cell redox homeostasis] evidence: IEA GeneID:84299 -> Biological process: GO:0051491 [positive regulation of filopodium assembly] evidence: IDA GeneID:84299 -> Cellular component: GO:0005829 [cytosol] evidence: IDA GeneID:84299 -> Cellular component: GO:0031235 [intrinsic to internal side of plasma membrane] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.