2024-04-19 09:11:59, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_031947 1417 bp mRNA linear PRI 07-JUL-2013 DEFINITION Homo sapiens solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 2 (SLC25A2), mRNA. ACCESSION NM_031947 VERSION NM_031947.2 GI:67944635 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1417) AUTHORS Monne,M., Miniero,D.V., Daddabbo,L., Robinson,A.J., Kunji,E.R. and Palmieri,F. TITLE Substrate specificity of the two mitochondrial ornithine carriers can be swapped by single mutation in substrate binding site JOURNAL J. Biol. Chem. 287 (11), 7925-7934 (2012) PUBMED 22262851 REMARK GeneRIF: characterized mutations of the proposed substrate binding site in ORC1 and ORC2; demonstrated that the residue at position 179 in the 2 soforms is largely responsible for the difference in their substrate specificity;concluded that Arg-179 is a key residue in the opening of the carrier to the matrix side REFERENCE 2 (bases 1 to 1417) AUTHORS Comuzzie,A.G., Cole,S.A., Laston,S.L., Voruganti,V.S., Haack,K., Gibbs,R.A. and Butte,N.F. TITLE Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population JOURNAL PLoS ONE 7 (12), E51954 (2012) PUBMED 23251661 REFERENCE 3 (bases 1 to 1417) AUTHORS Hendrickson,S.L., Lautenberger,J.A., Chinn,L.W., Malasky,M., Sezgin,E., Kingsley,L.A., Goedert,J.J., Kirk,G.D., Gomperts,E.D., Buchbinder,S.P., Troyer,J.L. and O'Brien,S.J. TITLE Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression JOURNAL PLoS ONE 5 (9), E12862 (2010) PUBMED 20877624 REMARK GeneRIF: Observational study of gene-disease association. (HuGE Navigator) Publication Status: Online-Only REFERENCE 4 (bases 1 to 1417) AUTHORS Trynka,G., Zhernakova,A., Romanos,J., Franke,L., Hunt,K.A., Turner,G., Bruinenberg,M., Heap,G.A., Platteel,M., Ryan,A.W., de Kovel,C., Holmes,G.K., Howdle,P.D., Walters,J.R., Sanders,D.S., Mulder,C.J., Mearin,M.L., Verbeek,W.H., Trimble,V., Stevens,F.M., Kelleher,D., Barisani,D., Bardella,M.T., McManus,R., van Heel,D.A. and Wijmenga,C. TITLE Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling JOURNAL Gut 58 (8), 1078-1083 (2009) PUBMED 19240061 REMARK GeneRIF: Observational study of gene-disease association. (HuGE Navigator) REFERENCE 5 (bases 1 to 1417) AUTHORS Fiermonte,G., Dolce,V., David,L., Santorelli,F.M., Dionisi-Vici,C., Palmieri,F. and Walker,J.E. TITLE The mitochondrial ornithine transporter. Bacterial expression, reconstitution, functional characterization, and tissue distribution of two human isoforms JOURNAL J. Biol. Chem. 278 (35), 32778-32783 (2003) PUBMED 12807890 REMARK GeneRIF: expression, reconstitution, functional characterization, and tissue distribution of two human isoforms ORC1 and ORC2 REFERENCE 6 (bases 1 to 1417) AUTHORS Camacho,J.A., Rioseco-Camacho,N., Andrade,D., Porter,J. and Kong,J. TITLE Cloning and characterization of human ORNT2: a second mitochondrial ornithine transporter that can rescue a defective ORNT1 in patients with the hyperornithinemia-hyperammonemia-homocitrullinuria syndrome, a urea cycle disorder JOURNAL Mol. Genet. Metab. 79 (4), 257-271 (2003) PUBMED 12948741 REMARK GeneRIF: Here we identify a new intronless gene, ORNT2, located on chromosome 5. REFERENCE 7 (bases 1 to 1417) AUTHORS Wu,Q., Zhang,T., Cheng,J.F., Kim,Y., Grimwood,J., Schmutz,J., Dickson,M., Noonan,J.P., Zhang,M.Q., Myers,R.M. and Maniatis,T. TITLE Comparative DNA sequence analysis of mouse and human protocadherin gene clusters JOURNAL Genome Res. 11 (3), 389-404 (2001) PUBMED 11230163 REFERENCE 8 (bases 1 to 1417) AUTHORS Porter,R.K. TITLE Mammalian mitochondrial inner membrane cationic and neutral amino acid carriers JOURNAL Biochim. Biophys. Acta 1459 (2-3), 356-362 (2000) PUBMED 11004451 REMARK Review article COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AF378119.1, AY208943.1 and AF332005.1. On Jun 17, 2005 this sequence version replaced gi:13994340. Summary: Located between the protocadherin beta and gamma gene clusters on chromosome 5, this intronless gene encodes a protein that is highly similar to an ornithine transporter localized in the mitochondrial inner membrane. The encoded protein most likely plays a role in metabolism as a mitochondrial transport protein. [provided by RefSeq, Jul 2008]. ##Evidence-Data-START## Transcript is intronless :: AF378119.1 [ECO:0000345] ##Evidence-Data-END## ##RefSeq-Attributes-START## gene product(s) localized to mito. :: reported by MitoCarta ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-721 AF378119.1 1-721 722-1410 AY208943.1 650-1338 1411-1417 AF332005.1 1231-1237 FEATURES Location/Qualifiers source 1..1417 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="5" /map="5q31" gene 1..1417 /gene="SLC25A2" /gene_synonym="ORC2; ORNT2" /note="solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 2" /db_xref="GeneID:83884" /db_xref="HGNC:22921" /db_xref="HPRD:12180" /db_xref="MIM:608157" exon 1..1417 /gene="SLC25A2" /gene_synonym="ORC2; ORNT2" /inference="alignment:Splign:1.39.8" misc_feature 172..174 /gene="SLC25A2" /gene_synonym="ORC2; ORNT2" /note="upstream in-frame stop codon" STS 181..1136 /gene="SLC25A2" /gene_synonym="ORC2; ORNT2" /db_xref="UniSTS:480968" CDS 181..1086 /gene="SLC25A2" /gene_synonym="ORC2; ORNT2" /note="ornithine transporter 2; solute carrier family 25 member 2" /codon_start=1 /product="mitochondrial ornithine transporter 2" /protein_id="NP_114153.1" /db_xref="GI:13994341" /db_xref="CCDS:CCDS4258.1" /db_xref="GeneID:83884" /db_xref="HGNC:22921" /db_xref="HPRD:12180" /db_xref="MIM:608157" /translation="
MKSGPGIQAAIDLTAGAAGGTACVLTGQPFDTIKVKMQTFPDLYKGLTDCFLKTYAQVGLRGFYKGTGPALMAYVAENSVLFMCYGFCQQFVRKVAGMDKQAKLSDLQTAAAGSFASAFAALALCPTELVKCRLQTMYEMEMSGKIAKSHNTIWSVVKGILKKDGPLGFYHGLSSTLLQEVPGYFFFFGGYELSRSFFASGRSKDELGPVHLMLSGGVAGICLWLVVFPVDCIKSRIQVLSMYGKQAGFIGTLLSVVRNEGIVALYSGLKATMIRAIPANGALFVAYEYSRKMMMKQLEAY
" misc_feature 193..255 /gene="SLC25A2" /gene_synonym="ORC2; ORNT2" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q9BXI2.3); transmembrane region" misc_feature 199..453 /gene="SLC25A2" /gene_synonym="ORC2; ORNT2" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q9BXI2.3); Region: Solcar 1" misc_feature 214..462 /gene="SLC25A2" /gene_synonym="ORC2; ORNT2" /note="Mitochondrial carrier protein; Region: Mito_carr; pfam00153" /db_xref="CDD:201040" misc_feature 382..444 /gene="SLC25A2" /gene_synonym="ORC2; ORNT2" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q9BXI2.3); transmembrane region" misc_feature 490..771 /gene="SLC25A2" /gene_synonym="ORC2; ORNT2" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q9BXI2.3); Region: Solcar 2" misc_feature 508..570 /gene="SLC25A2" /gene_synonym="ORC2; ORNT2" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q9BXI2.3); transmembrane region" misc_feature <553..774 /gene="SLC25A2" /gene_synonym="ORC2; ORNT2" /note="Mitochondrial carrier protein; Region: Mito_carr; pfam00153" /db_xref="CDD:201040" misc_feature 682..744 /gene="SLC25A2" /gene_synonym="ORC2; ORNT2" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q9BXI2.3); transmembrane region" misc_feature 793..1068 /gene="SLC25A2" /gene_synonym="ORC2; ORNT2" /note="Mitochondrial carrier protein; Region: Mito_carr; pfam00153" /db_xref="CDD:201040" misc_feature 799..1059 /gene="SLC25A2" /gene_synonym="ORC2; ORNT2" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q9BXI2.3); Region: Solcar 3" misc_feature 808..870 /gene="SLC25A2" /gene_synonym="ORC2; ORNT2" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q9BXI2.3); transmembrane region" misc_feature 889..951 /gene="SLC25A2" /gene_synonym="ORC2; ORNT2" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q9BXI2.3); transmembrane region" variation 620 /gene="SLC25A2" /gene_synonym="ORC2; ORNT2" /replace="c" /replace="t" /db_xref="dbSNP:34663948" variation 722 /gene="SLC25A2" /gene_synonym="ORC2; ORNT2" /replace="g" /replace="t" /db_xref="dbSNP:3749779" variation 856 /gene="SLC25A2" /gene_synonym="ORC2; ORNT2" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:3749780" variation 939 /gene="SLC25A2" /gene_synonym="ORC2; ORNT2" /replace="c" /replace="t" /db_xref="dbSNP:3749781" STS 1177..1327 /gene="SLC25A2" /gene_synonym="ORC2; ORNT2" /standard_name="RH92610" /db_xref="UniSTS:87951" polyA_site 1417 /gene="SLC25A2" /gene_synonym="ORC2; ORNT2" /experiment="experimental evidence, no additional details recorded" ORIGIN
cggagcgtagggttgagcggcttcccccgcactggggtgagagcccagaacaggcggtagagccaccccaccacccccaactccattccccgcgctcgctgcggctggacgtgaaaagccggtctcacgctctggggagttagtcgccttccactgggaccctcagacgagtgagcgaacatgaagtccggtcctggcatccaagccgccatcgacctcacagcgggggccgcaggggggacagcgtgtgtactgactgggcagcccttcgacacaataaaagtgaagatgcagacgttccctgacctgtacaagggcctcaccgactgcttcctgaagacatacgcccaagtgggtctccggggcttctacaagggcaccggcccggcacttatggcctacgtcgccgaaaactcggtcctcttcatgtgctacgggttctgccagcagtttgtcaggaaagtggctggaatggacaagcaggcaaagctgagtgatctccagactgcagccgcggggtccttcgcctctgcatttgctgcactggctctctgccccactgagcttgtgaagtgccggctacagaccatgtatgaaatggagatgtcagggaagatagcaaaaagccataatacaatttggtctgtcgtgaagggtatccttaaaaaggatggccccttgggcttctaccatggactctcgagtactctacttcaagaagtaccgggttatttctttttctttggtggctatgaactgagccgatcgttttttgcgtcagggagatcaaaagatgaactaggccctgtccatttgatgttaagtggtggagttgctggaatttgcctgtggcttgtcgtgttcccagtggattgtattaaatccagaattcaagttctttccatgtatgggaaacaggcaggatttattggtaccctcttaagtgttgtgagaaatgaaggaatagtagccttatattctggactgaaagctactatgattcgagcaatccctgccaatggggcactgtttgtggcctacgaatacagcaggaagatgatgatgaaacagttggaagcatactgaagtgtcttggtgaacctggatccgagtccatgagtttgaggactacagttcatcacagggttcagcagagtacaagaccactgtctaattttgacttcatgggaattttggttttatcttcccttcttctaccctaaatcttaactttatggaagggcctctattttacatcatataatttctgcccataattgtattgaaataggaaagttgctgctcttgcacttgctggaatgtacagggtgggctggttggccctatgtacctaatctgaaaaactaaatatcgttctgtcagggcctttgcataaagccatttgtgtgtacatgca
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:83884 -> Molecular function: GO:0000064 [L-ornithine transmembrane transporter activity] evidence: NAS GeneID:83884 -> Biological process: GO:0000050 [urea cycle] evidence: TAS GeneID:83884 -> Biological process: GO:0000066 [mitochondrial ornithine transport] evidence: NAS GeneID:83884 -> Biological process: GO:0034641 [cellular nitrogen compound metabolic process] evidence: TAS GeneID:83884 -> Biological process: GO:0044281 [small molecule metabolic process] evidence: TAS GeneID:83884 -> Cellular component: GO:0005743 [mitochondrial inner membrane] evidence: TAS GeneID:83884 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.