GGRNA Home | Help | Advanced search

2019-03-25 14:32:56, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_030981               1955 bp    mRNA    linear   PRI 05-MAY-2013
DEFINITION  Homo sapiens RAB1B, member RAS oncogene family (RAB1B), mRNA.
ACCESSION   NM_030981 XM_001134089
VERSION     NM_030981.2  GI:116014337
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1955)
  AUTHORS   Mochizuki,Y., Ohashi,R., Kawamura,T., Iwanari,H., Kodama,T.,
            Naito,M. and Hamakubo,T.
  TITLE     Phosphatidylinositol 3-phosphatase myotubularin-related protein 6
            (MTMR6) is regulated by small GTPase Rab1B in the early secretory
            and autophagic pathways
  JOURNAL   J. Biol. Chem. 288 (2), 1009-1021 (2013)
   PUBMED   23188820
  REMARK    GeneRIF: results indicate that the cellular localization of MTMR6
            is regulated by Rab1B in the early secretory and autophagic
            pathways
REFERENCE   2  (bases 1 to 1955)
  AUTHORS   Gavriljuk,K., Gazdag,E.M., Itzen,A., Kotting,C., Goody,R.S. and
            Gerwert,K.
  TITLE     Catalytic mechanism of a mammalian Rab.RabGAP complex in atomic
            detail
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 109 (52), 21348-21353 (2012)
   PUBMED   23236136
  REMARK    GeneRIF: The detailed molecular reaction mechanism of a complex
            between human Rab and RabGAP at the highest possible spatiotemporal
            resolution and in atomic detail, is described.
REFERENCE   3  (bases 1 to 1955)
  CONSRTM   Psychiatric GWAS Consortium Bipolar Disorder Working Group
  TITLE     Large-scale genome-wide association analysis of bipolar disorder
            identifies a new susceptibility locus near ODZ4
  JOURNAL   Nat. Genet. 43 (10), 977-983 (2011)
   PUBMED   21926972
  REMARK    Erratum:[Nat Genet. 2012 Sep;44(9):1072. Fullerton, Janice M
            [added]; Hyoun, Phil L [corrected to Lee, Phil H]; Meng, Fan Guo
            [corrected to Meng, Fan]]
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1955)
  AUTHORS   Zenner,H.L., Yoshimura,S., Barr,F.A. and Crump,C.M.
  TITLE     Analysis of Rab GTPase-activating proteins indicates that Rab1a/b
            and Rab43 are important for herpes simplex virus 1 secondary
            envelopment
  JOURNAL   J. Virol. 85 (16), 8012-8021 (2011)
   PUBMED   21680502
  REMARK    GeneRIF: Rab1a/b and Rab43, are important for herpes simplex virus
            1 virion assembly
REFERENCE   5  (bases 1 to 1955)
  AUTHORS   Slavin,I., Garcia,I.A., Monetta,P., Martinez,H., Romero,N. and
            Alvarez,C.
  TITLE     Role of Rab1b in COPII dynamics and function
  JOURNAL   Eur. J. Cell Biol. 90 (4), 301-311 (2011)
   PUBMED   21093099
  REMARK    GeneRIF: Rab1b is a key regulatory component of COPII dynamics and
            function.
REFERENCE   6  (bases 1 to 1955)
  AUTHORS   Overmeyer,J.H., Wilson,A.L., Erdman,R.A. and Maltese,W.A.
  TITLE     The putative 'switch 2' domain of the Ras-related GTPase, Rab1B,
            plays an essential role in the interaction with Rab escort protein
  JOURNAL   Mol. Biol. Cell 9 (1), 223-235 (1998)
   PUBMED   9437002
REFERENCE   7  (bases 1 to 1955)
  AUTHORS   Chen,D., Guo,J. and Gahl,W.A.
  TITLE     RAB GTPases expressed in human melanoma cells
  JOURNAL   Biochim. Biophys. Acta 1355 (1), 1-6 (1997)
   PUBMED   9030196
REFERENCE   8  (bases 1 to 1955)
  AUTHORS   Wilson,A.L., Sheridan,K.M., Erdman,R.A. and Maltese,W.A.
  TITLE     Prenylation of a Rab1B mutant with altered GTPase activity is
            impaired in cell-free systems but not in intact mammalian cells
  JOURNAL   Biochem. J. 318 (PT 3), 1007-1014 (1996)
   PUBMED   8836150
REFERENCE   9  (bases 1 to 1955)
  AUTHORS   Soldati,T., Rancano,C., Geissler,H. and Pfeffer,S.R.
  TITLE     Rab7 and Rab9 are recruited onto late endosomes by biochemically
            distinguishable processes
  JOURNAL   J. Biol. Chem. 270 (43), 25541-25548 (1995)
   PUBMED   7592724
REFERENCE   10 (bases 1 to 1955)
  AUTHORS   Plutner,H., Cox,A.D., Pind,S., Khosravi-Far,R., Bourne,J.R.,
            Schwaninger,R., Der,C.J. and Balch,W.E.
  TITLE     Rab1b regulates vesicular transport between the endoplasmic
            reticulum and successive Golgi compartments
  JOURNAL   J. Cell Biol. 115 (1), 31-43 (1991)
   PUBMED   1918138
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BG717501.1, AL136635.1 and AP001107.5.
            On Oct 11, 2006 this sequence version replaced gi:13569961.
            
            Summary: Members of the RAB protein family, such as RAB1B, are low
            molecular mass monomeric GTPases localized on the cytoplasmic
            surfaces of distinct membrane-bound organelles. RAB1B functions in
            the early secretory pathway and is essential for vesicle transport
            between the endoplasmic reticulum (ER) and Golgi (Chen et al., 1997
            [PubMed 9030196]; Alvarez et al., 2003 [PubMed 12802079]).[supplied
            by OMIM, Jan 2009].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AL136635.1, AJ245875.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025082 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-49                BG717501.1         6-54
            50-762              AL136635.1         2-714
            763-1955            AP001107.5         16556-17748
FEATURES             Location/Qualifiers
     source          1..1955
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="11"
                     /map="11q12"
     gene            1..1955
                     /gene="RAB1B"
                     /note="RAB1B, member RAS oncogene family"
                     /db_xref="GeneID:81876"
                     /db_xref="HGNC:18370"
                     /db_xref="HPRD:11469"
                     /db_xref="MIM:612565"
     exon            1..109
                     /gene="RAB1B"
                     /inference="alignment:Splign:1.39.8"
     variation       23
                     /gene="RAB1B"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:112419770"
     variation       86
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199656742"
     CDS             96..701
                     /gene="RAB1B"
                     /note="small GTP-binding protein"
                     /codon_start=1
                     /product="ras-related protein Rab-1B"
                     /protein_id="NP_112243.1"
                     /db_xref="GI:13569962"
                     /db_xref="CCDS:CCDS31613.1"
                     /db_xref="GeneID:81876"
                     /db_xref="HGNC:18370"
                     /db_xref="HPRD:11469"
                     /db_xref="MIM:612565"
                     /translation="
MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC
"
     misc_feature    96..98
                     /gene="RAB1B"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N-acetylmethionine; propagated from
                     UniProtKB/Swiss-Prot (Q9H0U4.1); acetylation site"
     misc_feature    108..698
                     /gene="RAB1B"
                     /note="Rab family protein; Provisional; Region: PLN03108"
                     /db_xref="CDD:178655"
     misc_feature    114..611
                     /gene="RAB1B"
                     /note="Rab GTPase family 1 includes the yeast homolog
                     Ypt1; Region: Rab1_Ypt1; cd01869"
                     /db_xref="CDD:206661"
     misc_feature    114..125
                     /gene="RAB1B"
                     /note="Rab subfamily motif 1 (RabSF1); other site"
                     /db_xref="CDD:206661"
     misc_feature    138..161
                     /gene="RAB1B"
                     /note="G1 box; other site"
                     /db_xref="CDD:206661"
     misc_feature    order(141..143,147..164,192..194,456..461,465..467,
                     546..554)
                     /gene="RAB1B"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206661"
     misc_feature    order(162..197,204..212)
                     /gene="RAB1B"
                     /note="Rab subfamily motif 2 (RabSF2); other site"
                     /db_xref="CDD:206661"
     misc_feature    order(192..194,207..233)
                     /gene="RAB1B"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206661"
     misc_feature    204..230
                     /gene="RAB1B"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9H0U4.1);
                     Region: Effector region (By similarity)"
     misc_feature    order(207..209,219..242,261..263,267..269)
                     /gene="RAB1B"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206661"
     misc_feature    213..215
                     /gene="RAB1B"
                     /note="G2 box; other site"
                     /db_xref="CDD:206661"
     misc_feature    order(216..218,222..230,273..275,279..281,300..305,
                     312..314,324..326,330..341,600..602)
                     /gene="RAB1B"
                     /note="putative effector interaction site; other site"
                     /db_xref="CDD:206661"
     misc_feature    order(216..221,225..227,279..284,303..305,309..311,
                     315..323,330..332)
                     /gene="RAB1B"
                     /note="GDI interaction site; other site"
                     /db_xref="CDD:206661"
     misc_feature    216..230
                     /gene="RAB1B"
                     /note="Rab family motif 1 (RabF1); other site"
                     /db_xref="CDD:206661"
     misc_feature    267..281
                     /gene="RAB1B"
                     /note="Rab family motif 2 (RabF2); other site"
                     /db_xref="CDD:206661"
     misc_feature    282..293
                     /gene="RAB1B"
                     /note="G3 box; other site"
                     /db_xref="CDD:206661"
     misc_feature    285..344
                     /gene="RAB1B"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9H0U4.1);
                     Region: Switch 2 region, required for interaction with
                     REP1/CHM"
     misc_feature    order(291..293,297..329)
                     /gene="RAB1B"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206661"
     misc_feature    300..317
                     /gene="RAB1B"
                     /note="Rab family motif 3 (RabF3); other site"
                     /db_xref="CDD:206661"
     misc_feature    321..323
                     /gene="RAB1B"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="O-(2-cholinephosphoryl)serine, by Legionella AnkX;
                     propagated from UniProtKB/Swiss-Prot (Q9H0U4.1);
                     phosphorylation site"
     misc_feature    324..338
                     /gene="RAB1B"
                     /note="Rab family motif 4 (RabF4); other site"
                     /db_xref="CDD:206661"
     misc_feature    324..326
                     /gene="RAB1B"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="O-AMP-tyrosine, by Legionella DrrA; propagated from
                     UniProtKB/Swiss-Prot (Q9H0U4.1); modified site"
     misc_feature    351..368
                     /gene="RAB1B"
                     /note="Rab family motif 5 (RabF5); other site"
                     /db_xref="CDD:206661"
     misc_feature    429..449
                     /gene="RAB1B"
                     /note="Rab subfamily motif 3 (RabSF3); other site"
                     /db_xref="CDD:206661"
     misc_feature    456..467
                     /gene="RAB1B"
                     /note="G4 box; other site"
                     /db_xref="CDD:206661"
     misc_feature    546..554
                     /gene="RAB1B"
                     /note="G5 box; other site"
                     /db_xref="CDD:206661"
     misc_feature    594..611
                     /gene="RAB1B"
                     /note="Rab subfamily motif 4 (RabSF4); other site"
                     /db_xref="CDD:206661"
     exon            110..182
                     /gene="RAB1B"
                     /inference="alignment:Splign:1.39.8"
     variation       149
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140622155"
     variation       164
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375361090"
     exon            183..278
                     /gene="RAB1B"
                     /inference="alignment:Splign:1.39.8"
     variation       230
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369688518"
     exon            279..374
                     /gene="RAB1B"
                     /inference="alignment:Splign:1.39.8"
     variation       329
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146494531"
     variation       354
                     /gene="RAB1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11555385"
     exon            375..506
                     /gene="RAB1B"
                     /inference="alignment:Splign:1.39.8"
     variation       383
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149085050"
     variation       418
                     /gene="RAB1B"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:143206894"
     variation       434
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372476957"
     variation       439
                     /gene="RAB1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371245994"
     variation       464
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199961685"
     variation       488
                     /gene="RAB1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61734075"
     exon            507..1955
                     /gene="RAB1B"
                     /inference="alignment:Splign:1.39.8"
     variation       519
                     /gene="RAB1B"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:148276108"
     variation       545
                     /gene="RAB1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61730423"
     variation       566
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375241856"
     variation       570
                     /gene="RAB1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140356034"
     variation       578
                     /gene="RAB1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367843963"
     variation       635
                     /gene="RAB1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375965398"
     variation       638
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371996451"
     variation       659
                     /gene="RAB1B"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371190814"
     variation       660
                     /gene="RAB1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:189228025"
     variation       669
                     /gene="RAB1B"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:202183182"
     variation       680
                     /gene="RAB1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200992788"
     variation       686
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368830540"
     variation       711
                     /gene="RAB1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:181942452"
     variation       719
                     /gene="RAB1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376404350"
     variation       735..737
                     /gene="RAB1B"
                     /replace=""
                     /replace="aag"
                     /db_xref="dbSNP:3831389"
     variation       737..739
                     /gene="RAB1B"
                     /replace=""
                     /replace="tct"
                     /db_xref="dbSNP:148632819"
     variation       741
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369483409"
     variation       826
                     /gene="RAB1B"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:142287299"
     variation       837
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147898756"
     variation       858
                     /gene="RAB1B"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:3203695"
     variation       869..870
                     /gene="RAB1B"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:3203696"
     variation       881
                     /gene="RAB1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185769648"
     variation       890
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2508657"
     variation       903
                     /gene="RAB1B"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:7350526"
     variation       943
                     /gene="RAB1B"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:191763879"
     variation       978
                     /gene="RAB1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368927222"
     variation       996
                     /gene="RAB1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183229926"
     variation       1051..1053
                     /gene="RAB1B"
                     /replace=""
                     /replace="ttc"
                     /db_xref="dbSNP:373550360"
     variation       1052
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186183603"
     variation       1092
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:79035573"
     variation       1252
                     /gene="RAB1B"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:113221195"
     variation       1414
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112770037"
     variation       1446
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:191429393"
     variation       1481
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1043243"
     variation       1510
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141611198"
     variation       1541
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371962546"
     variation       1542
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11227443"
     variation       1549
                     /gene="RAB1B"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:11227444"
     variation       1598
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1043248"
     STS             1604..1735
                     /gene="RAB1B"
                     /standard_name="RH69692"
                     /db_xref="UniSTS:88413"
     variation       1623
                     /gene="RAB1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:9666374"
     variation       1640
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11227445"
     variation       1682
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11227446"
     variation       1749
                     /gene="RAB1B"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:17411313"
     variation       1757
                     /gene="RAB1B"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:3211179"
     variation       1757
                     /gene="RAB1B"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:17411320"
     variation       1766
                     /gene="RAB1B"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:3211180"
     variation       1766
                     /gene="RAB1B"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:17414987"
     variation       1768
                     /gene="RAB1B"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:374788736"
     variation       1768
                     /gene="RAB1B"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:3211181"
     variation       1768
                     /gene="RAB1B"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:17414994"
     variation       1809
                     /gene="RAB1B"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:17842199"
     variation       1811
                     /gene="RAB1B"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:34247845"
     variation       1822
                     /gene="RAB1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145468882"
     variation       1854
                     /gene="RAB1B"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:34038114"
     variation       1874
                     /gene="RAB1B"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1043303"
     variation       1928..1929
                     /gene="RAB1B"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:35154090"
ORIGIN      
gcgggcggggcctctggggcggagcggccaccatcttggaacgggaggcggagcagagtcgactgggagcgaccgagcgggccgccgccgccgccatgaaccccgaatatgactacctgtttaagctgcttttgattggcgactcaggcgtgggcaagtcatgcctgctcctgcggtttgctgatgacacgtacacagagagctacatcagcaccatcggggtggacttcaagatccgaaccatcgagctggatggcaaaactatcaaacttcagatctgggacacagcgggccaggaacggttccggaccatcacttccagctactaccggggggctcatggcatcatcgtggtgtatgacgtcactgaccaggaatcctacgccaacgtgaagcagtggctgcaggagattgaccgctatgccagcgagaacgtcaataagctcctggtgggcaacaagagcgacctcaccaccaagaaggtggtggacaacaccacagccaaggagtttgcagactctctgggcatccccttcttggagacgagcgccaagaatgccaccaatgtcgagcaggcgttcatgaccatggctgctgaaatcaaaaagcggatggggcctggagcagcctctgggggcgagcggcccaatctcaagatcgacagcacccctgtaaagccggctggcggtggctgttgctaggaggggcacatggagtgggacaggagggggcaccttctccagatgatgtccctggagggggcaggaggtacctccctctccctctcctggggcatttgagtctgtggctttggggtgtcctgggctccccatctccttctggcccatctgcctgctgccctgagccccggttctgtcagggtccctaagggaggacactcagggcctgtggccaggcagggcggaggcctgctgtgctgttgcctctaggtgactttccaagatgcccccctacacacctttctttggaacgagggctcttctgtcggtgtccctcccacccccatgtatgctgcactgggttctctccttcttcttcctgctgtcctgcccaagaactgagggtctccccggcctctactgccctggctgcagtcagtgcccagggcgaggaatgtggccaggggatccaggacctgggatccagggccctgggctggacctcaggacaggcatggaggccacaggggcccagcagcccaccctttcctctccccactgcctcctctcccttcctacactcccagctcgagccgtccagctgcggtgggatctgagtatatctagggcgggtgggcgggtagcagtgctgggcctgtgtcttgagcctggagggagtctgctcctgccgccctctgccctgccagagacagacccatgcgctgcctgcccaccgtgcccctttgtccccatgtcaggcggaggcggaaggcccaccgtgccagaggctgggcaccagccttaaccctcactctgctagcacctcctccctttccccaaggtagcacatctggctcactccccactccgtctctggagcccaccagggaaggccctcatcccctgccgctacttctctggggaatgtgggttccatccaggattgggggcctctctgctcacccactctgcacccaggatcctagtcccctgccctctggcacagctgcttcctgcaagaaagcaagtctttggtctccctgagaagccatgtccctcgtgctgtctcttgcctgtcccacctgtgccctgccctccagcttgtatttaagtccctgggctgcccccttggggtgccccccgctcccaggttcccctctggtgtcatgtcaggcattttgcaaggaaaagccacttggggaaagatggaaaaggacaaaaaaaattaataaatttccattggccctcgggtgagctgagggtttttgcaaggaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:81876 -> Molecular function: GO:0005525 [GTP binding] evidence: IDA
            GeneID:81876 -> Biological process: GO:0007264 [small GTPase mediated signal transduction] evidence: IEA
            GeneID:81876 -> Biological process: GO:0015031 [protein transport] evidence: IEA
            GeneID:81876 -> Cellular component: GO:0005739 [mitochondrion] evidence: IEA
            GeneID:81876 -> Cellular component: GO:0005794 [Golgi apparatus] evidence: IDA
            GeneID:81876 -> Cellular component: GO:0016020 [membrane] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.