Home |
Help |
Advanced search
2024-04-20 21:23:26, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_030766 2039 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens BCL2-like 14 (apoptosis facilitator) (BCL2L14),
transcript variant 2, mRNA.
ACCESSION NM_030766
VERSION NM_030766.1 GI:13540528
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2039)
AUTHORS Al-Shehhi,H., Konn,Z.J., Schwab,C.J., Erhorn,A., Barber,K.E.,
Wright,S.L., Gabriel,A.S., Harrison,C.J. and Moorman,A.V.
TITLE Abnormalities of the der(12)t(12;21) in ETV6-RUNX1 acute
lymphoblastic leukemia
JOURNAL Genes Chromosomes Cancer 52 (2), 202-213 (2013)
PUBMED 23077088
REMARK GeneRIF: Data indicate that LRP6, BCL2L14, DUSP16, CREBL2, and
CDKN1B were involed in centromeric (12p11.21-12p13.2) deletion in
ETV6-RUNX1 B-cell precursor acute lymphoblastic leukemia (BCP-ALL).
REFERENCE 2 (bases 1 to 2039)
AUTHORS Spitz,M.R., Gorlov,I.P., Dong,Q., Wu,X., Chen,W., Chang,D.W.,
Etzel,C.J., Caporaso,N.E., Zhao,Y., Christiani,D.C., Brennan,P.,
Albanes,D., Shi,J., Thun,M., Landi,M.T. and Amos,C.I.
TITLE Multistage analysis of variants in the inflammation pathway and
lung cancer risk in smokers
JOURNAL Cancer Epidemiol. Biomarkers Prev. 21 (7), 1213-1221 (2012)
PUBMED 22573796
REMARK GeneRIF: Single nucleotide polymorphism in BCL2L14 is associated
with lung cancer.
REFERENCE 3 (bases 1 to 2039)
AUTHORS Pickard,M.R., Mourtada-Maarabouni,M. and Williams,G.T.
TITLE Candidate tumour suppressor Fau regulates apoptosis in human cells:
an essential role for Bcl-G
JOURNAL Biochim. Biophys. Acta 1812 (9), 1146-1153 (2011)
PUBMED 21550398
REMARK GeneRIF: prior knockdown of Bcl-G expression ablates the
stimulation of basal apoptosis by FAU, consistent with an essential
downstream role for Bcl-G, itself a candidate tumour suppressor, in
mediating the apoptosis regulatory role of FAU.
REFERENCE 4 (bases 1 to 2039)
AUTHORS Kelly,J.L., Novak,A.J., Fredericksen,Z.S., Liebow,M., Ansell,S.M.,
Dogan,A., Wang,A.H., Witzig,T.E., Call,T.G., Kay,N.E.,
Habermann,T.M., Slager,S.L. and Cerhan,J.R.
TITLE Germline variation in apoptosis pathway genes and risk of
non-Hodgkin's lymphoma
JOURNAL Cancer Epidemiol. Biomarkers Prev. 19 (11), 2847-2858 (2010)
PUBMED 20855536
REMARK GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
REFERENCE 5 (bases 1 to 2039)
AUTHORS Liu,X., Pan,Z., Zhang,L., Sun,Q., Wan,J., Tian,C., Xing,G.,
Yang,J., Liu,X., Jiang,J. and He,F.
TITLE JAB1 accelerates mitochondrial apoptosis by interaction with
proapoptotic BclGs
JOURNAL Cell. Signal. 20 (1), 230-240 (2008)
PUBMED 18006276
REMARK GeneRIF: JAB1 is involved in the regulation of mitochondrial
apoptotic pathway through specific interaction with BclGs.
REFERENCE 6 (bases 1 to 2039)
AUTHORS Montpetit,A., Larose,J., Boily,G., Langlois,S., Trudel,N. and
Sinnett,D.
TITLE Mutational and expression analysis of the chromosome 12p candidate
tumor suppressor genes in pre-B acute lymphoblastic leukemia
JOURNAL Leukemia 18 (9), 1499-1504 (2004)
PUBMED 15284860
REFERENCE 7 (bases 1 to 2039)
AUTHORS Kutsenko,A.S., Gizatullin,R.Z., Al-Amin,A.N., Wang,F., Kvasha,S.M.,
Podowski,R.M., Matushkin,Y.G., Gyanchandani,A., Muravenko,O.V.,
Levitsky,V.G., Kolchanov,N.A., Protopopov,A.I., Kashuba,V.I.,
Kisselev,L.L., Wasserman,W., Wahlestedt,C. and Zabarovsky,E.R.
TITLE NotI flanking sequences: a tool for gene discovery and verification
of the human genome
JOURNAL Nucleic Acids Res. 30 (14), 3163-3170 (2002)
PUBMED 12136098
REFERENCE 8 (bases 1 to 2039)
AUTHORS Montpetit,A., Boily,G. and Sinnett,D.
TITLE A detailed transcriptional map of the chromosome 12p12 tumour
suppressor locus
JOURNAL Eur. J. Hum. Genet. 10 (1), 62-71 (2002)
PUBMED 11896457
REFERENCE 9 (bases 1 to 2039)
AUTHORS Ozalp,S.S., Yalcin,O.T., Tanir,H.M., Dundar,E. and Yildirim,S.
TITLE Bcl-2 expression in preinvasive and invasive cervical lesions
JOURNAL Eur. J. Gynaecol. Oncol. 23 (5), 419-422 (2002)
PUBMED 12440815
REFERENCE 10 (bases 1 to 2039)
AUTHORS Guo,B., Godzik,A. and Reed,J.C.
TITLE Bcl-G, a novel pro-apoptotic member of the Bcl-2 family
JOURNAL J. Biol. Chem. 276 (4), 2780-2785 (2001)
PUBMED 11054413
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AF281255.1.
Summary: The protein encoded by this gene belongs to the BCL2
protein family. BCL2 family members form hetero- or homodimers and
act as anti- or pro-apoptotic regulators that are involved in a
wide variety of cellular activities. Overexpression of this gene
has been shown to induce apoptosis in cells. Three alternatively
spliced transcript variants encoding two distinct isoforms have
been reported for this gene. [provided by RefSeq, May 2009].
Transcript Variant: This variant (2) is also known as BCL-G short
form. It contains an extra segment within the coding region, which
results in a frameshift, when compared to variant 1. This variant
encodes an isoform (2) that contains a shorter and distinct C
terminus, as compared to isoform 1.
CCDS Note: This CCDS ID is based on AF281255.1. This transcript
appears to be a nonsense-mediated mRNA decay (NMD) candidate;
however, there are publications describing this transcript and its
encoded protein (Guo et al, 2001, PMID 11054413; Liu et al, 2008,
PMID 18006276) so this CCDS ID has been retained.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AF281255.1 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
ERS025083, ERS025084 [ECO:0000350]
##Evidence-Data-END##
##RefSeq-Attributes-START##
NMD candidate :: PMID: 18362212, 18006276, 11054413
##RefSeq-Attributes-END##
COMPLETENESS: complete on the 3' end.
FEATURES Location/Qualifiers
source 1..2039
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="12"
/map="12p13-p12"
gene 1..2039
/gene="BCL2L14"
/gene_synonym="BCLG"
/note="BCL2-like 14 (apoptosis facilitator)"
/db_xref="GeneID:79370"
/db_xref="HGNC:16657"
/db_xref="MIM:606126"
exon 1..188
/gene="BCL2L14"
/gene_synonym="BCLG"
/inference="alignment:Splign:1.39.8"
variation 83
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="g"
/replace="t"
/db_xref="dbSNP:75691667"
misc_feature 97..99
/gene="BCL2L14"
/gene_synonym="BCLG"
/note="upstream in-frame stop codon"
variation 142
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:2287154"
variation 171
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="c"
/db_xref="dbSNP:377313330"
exon 189..628
/gene="BCL2L14"
/gene_synonym="BCLG"
/inference="alignment:Splign:1.39.8"
CDS 196..954
/gene="BCL2L14"
/gene_synonym="BCLG"
/note="isoform 2 is encoded by transcript variant 2;
apoptosis regulator BCL-G; apoptosis facilitator
Bcl-2-like protein 14; bcl2-L-14"
/codon_start=1
/product="apoptosis facilitator Bcl-2-like protein 14
isoform 2"
/protein_id="NP_110393.1"
/db_xref="GI:13540529"
/db_xref="CCDS:CCDS8646.1"
/db_xref="GeneID:79370"
/db_xref="HGNC:16657"
/db_xref="MIM:606126"
/translation="
MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKDTAFIPIPLVDTSIQGFPQDGLMACI
"
variation 203
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="g"
/replace="t"
/db_xref="dbSNP:59599134"
variation 213
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="g"
/db_xref="dbSNP:139406698"
variation 239
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:61733244"
variation 241
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="g"
/db_xref="dbSNP:370415348"
variation 260
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:61733245"
variation 276
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:61733246"
variation 277
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:142096906"
variation 295
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:141156172"
variation 350
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:376083367"
variation 352
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:142250889"
variation 362
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:371514083"
variation 366
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:374164865"
variation 377
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="g"
/db_xref="dbSNP:368530005"
variation 402
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:61733247"
variation 409
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:140584428"
variation 503
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:371624447"
variation 510
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:138260830"
variation 511
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:376032131"
variation 519
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:186696253"
variation 522
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="g"
/replace="t"
/db_xref="dbSNP:367663061"
variation 545
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:141892443"
variation 551
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:149592138"
variation 589
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="c"
/db_xref="dbSNP:3815568"
variation 603
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:61729499"
variation 604
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:200779523"
variation 622
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="c"
/db_xref="dbSNP:372836511"
exon 629..802
/gene="BCL2L14"
/gene_synonym="BCLG"
/inference="alignment:Splign:1.39.8"
variation 640
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="g"
/replace="t"
/db_xref="dbSNP:2416948"
variation 652
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:138853585"
variation 681
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:879732"
variation 764..765
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace=""
/replace="c"
/db_xref="dbSNP:36104369"
variation 767
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:113665428"
variation 776
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:375463687"
variation 779
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:369864408"
variation 781
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:17819796"
variation 782
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="t"
/db_xref="dbSNP:139476893"
variation 783
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:139420279"
exon 803..873
/gene="BCL2L14"
/gene_synonym="BCLG"
/inference="alignment:Splign:1.39.8"
variation 808
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:141761714"
variation 819
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:150568064"
exon 874..1293
/gene="BCL2L14"
/gene_synonym="BCLG"
/inference="alignment:Splign:1.39.8"
misc_feature 874..1026
/gene="BCL2L14"
/gene_synonym="BCLG"
/note="Region: the region absent in variant 1"
variation 889
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:200229629"
variation 908
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="g"
/db_xref="dbSNP:369434316"
variation 919
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:143976011"
variation 951
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:4763779"
variation 978
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:188940783"
variation 998
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:202074056"
variation 1004
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:373995100"
variation 1023
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:11054682"
variation 1045
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:11054683"
variation 1095
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="g"
/db_xref="dbSNP:370468556"
variation 1123
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="c"
/db_xref="dbSNP:61738409"
variation 1130
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:148640639"
variation 1149
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:139549265"
variation 1178
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:202089461"
variation 1179
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="c"
/db_xref="dbSNP:145041635"
variation 1180
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:147550863"
variation 1185
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:61753207"
variation 1186
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:201867584"
variation 1222
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="t"
/db_xref="dbSNP:61739220"
variation 1242
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:367766873"
variation 1265
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:73053321"
variation 1278
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:372228342"
exon 1294..2039
/gene="BCL2L14"
/gene_synonym="BCLG"
/inference="alignment:Splign:1.39.8"
variation 1338
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="g"
/db_xref="dbSNP:376810924"
variation 1360
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="g"
/db_xref="dbSNP:368337681"
variation 1452
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:150017586"
variation 1472
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:369077886"
variation 1488
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="g"
/replace="t"
/db_xref="dbSNP:1797647"
variation 1491
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:185276807"
variation 1523
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="g"
/replace="t"
/db_xref="dbSNP:367916967"
STS 1558..1707
/gene="BCL2L14"
/gene_synonym="BCLG"
/standard_name="WI-16673"
/db_xref="UniSTS:71275"
variation 1670
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="t"
/db_xref="dbSNP:146725411"
variation 1687
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:140363991"
variation 1723
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="a"
/replace="g"
/db_xref="dbSNP:201488916"
variation 1937
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace=""
/replace="c"
/db_xref="dbSNP:370512417"
polyA_signal 2010..2015
/gene="BCL2L14"
/gene_synonym="BCLG"
variation 2020
/gene="BCL2L14"
/gene_synonym="BCLG"
/replace="c"
/replace="t"
/db_xref="dbSNP:190517309"
polyA_site 2039
/gene="BCL2L14"
/gene_synonym="BCLG"
/experiment="experimental evidence, no additional details
recorded"
ORIGIN
aatgacatgacagccattccgtggccagggacaccactgcccaagctggagaccacgaggattcagggactgaagccagcatgggaattcctggtttgagatcagagtcctgagtacctcgtgggaacttgggcactcatccgcaggaggtctagacccccagagaattccttgagtctaaggcacaggcccaacatgtgtagcaccagtgggtgtgacctggaagaaatccccctagatgatgatgacctaaacaccatagaattcaaaatcctcgcctactacaccagacatcatgtcttcaagagcacccctgctctcttctcaccaaagctgctgagaacaagaagtttgtcccagaggggcctggggaattgttcagcaaatgagtcatggacagaggtgtcatggccttgcagaaattcccaatccagtgagaaggccataaaccttggcaagaaaaagtcttcttggaaagcattctttggagtagtggagaaggaagattcgcagagcacgcctgccaaggtctctgctcagggtcaaaggacgttggaataccaagattcgcacagccagcagtggtccaggtgtctttctaacgtggagcagtgcttggagcatgaagctgtggaccccaaagtcatttccattgccaaccgagtagctgaaattgtttactcctggccaccaccacaagcgacccaggcaggaggcttcaagtccaaagagatttttgtaactgagggtctctccttccagctccaaggccacgtgcctgtagcttcaagttctaagaaagatgaagaagaacaaatactagccaaaattgttgagctgctgaaatattcaggagatcagttggaaagaaaggacactgccttcatccccattcccttggttgacaccagcatccagggttttccacaggatggtttgatggcctgcatttgagctaaagaatgaacttctgtctgcctcgtggagccaagctactgtactgagtgcttattcttttgtacacagctgaagaaagataaggctttgatgggccacttccaggatgggctgtcctactctgttttcaagaccatcacagaccaggtcctaatgggtgtggaccccaggggagaatcagaggtcaaagctcagggctttaaggctgcccttgtaatagacgtcacggccaagctcacagctattgacaaccacccgatgaacagggtcctgggctttggcaccaagtacctgaaagagaacttctcgccatggatccagcagcacggtggatgggaaaaaatacttgggatatcacatgaagaagtagactgaaatatcagatttgtcatcaggaatactctttgtctactgtggtcctgtgcacgttggcctcagatggactacaggagattacaacgtacaaggcagatggagcattgacgttttcaaaaccattattcctgtgactggagaggcatcaggagaggtctcgttcgtctccagctcataaaatgtagcagcatcatccttgacagtgatgtttttcaggccctccattgagaacctgaggaaatctgtaaagataagtggtgatgttgtttcaaacgttcagaacagataccatcatcctgcctttgttagctgctgtagggaaagtgcgttacagatgtctgctgacctcacaagagtgaaaagataaactgtgcatgtgtttccacttccgtttctagtactatttatttttaaactacacttggggtggcctaatacctaggaagatgttgctattcacgttagtaaacagcctaaagaaactcttaggtttactgctacatccatttgtttggagaggtaactgttgtctgtgcctttttgaaaaacttccatttggtacaaaatttttactccaacaccccctcaacccttttctcagggaccacacctcttcttcccaaggtccctgggacttcctcattctttgtggtagtacaatgattggtagcaggtaaaataaatacatagaaagactactgtcaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:79370 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:79370 -> Molecular function: GO:0019901 [protein kinase binding] evidence: IPI
GeneID:79370 -> Biological process: GO:0006915 [apoptotic process] evidence: IDA
GeneID:79370 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: IEA
GeneID:79370 -> Biological process: GO:2001238 [positive regulation of extrinsic apoptotic signaling pathway] evidence: IDA
GeneID:79370 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:79370 -> Cellular component: GO:0005829 [cytosol] evidence: IDA
GeneID:79370 -> Cellular component: GO:0012505 [endomembrane system] evidence: IEA
GeneID:79370 -> Cellular component: GO:0016020 [membrane] evidence: IEA
GeneID:79370 -> Cellular component: GO:0043229 [intracellular organelle] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.