2024-03-29 22:19:58, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_024626 2652 bp mRNA linear PRI 02-JUN-2013 DEFINITION Homo sapiens V-set domain containing T cell activation inhibitor 1 (VTCN1), transcript variant 1, mRNA. ACCESSION NM_024626 VERSION NM_024626.3 GI:359718942 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2652) AUTHORS Abadi,Y.M., Jeon,H., Ohaegbulam,K.C., Scandiuzzi,L., Ghosh,K., Hofmeyer,K.A., Lee,J.S., Ray,A., Gravekamp,C. and Zang,X. TITLE Host b7x promotes pulmonary metastasis of breast cancer JOURNAL J. Immunol. 190 (7), 3806-3814 (2013) PUBMED 23455497 REMARK GeneRIF: B7x may enable metastasizing cancer cells to escape local antitumor immune responses through interactions with the innate and adaptive immune systems. REFERENCE 2 (bases 1 to 2652) AUTHORS Fauci,J.M., Straughn,J.M. Jr., Ferrone,S. and Buchsbaum,D.J. TITLE A review of B7-H3 and B7-H4 immune molecules and their role in ovarian cancer JOURNAL Gynecol. Oncol. 127 (2), 420-425 (2012) PUBMED 22910694 REMARK GeneRIF: A review of B7-H3 and B7-H4 immune molecules and the role their overexpression plays in ovarian cancer. Review article REFERENCE 3 (bases 1 to 2652) AUTHORS Galazka,K., Oplawski,M., Windorbska,W., Skret-Magierlo,J., Koper,K., Basta,P., Mach,P., Dutch-Wicherek,M., Mazur,A. and Wicherek,L. TITLE The immunohistochemical analysis of antigens such as RCAS1 and B7H4 in the cervical cancer nest and within the fibroblasts and macrophages infiltrating the cancer microenvironment JOURNAL Am. J. Reprod. Immunol. 68 (1), 85-93 (2012) PUBMED 22530960 REMARK GeneRIF: The intensity of the suppressive profile of the cervical cancer microenvironment indicated by the presence of both RCAS1 and B7H4 on the front of the tumor and in the macrophages and fibroblasts infiltrating the cancer stroma REFERENCE 4 (bases 1 to 2652) AUTHORS Zheng,X., Li,X.D., Wu,C.P., Lu,B.F. and Jiang,J.T. TITLE Expression of costimulatory molecule B7-H4 in human malignant tumors JOURNAL Onkologie 35 (11), 700-705 (2012) PUBMED 23147549 REMARK GeneRIF: B7-H4 expression in malignant tumors is useful for clinical diagnosis, and may provide a novel molecular target for cancer treatment.[review] Review article REFERENCE 5 (bases 1 to 2652) AUTHORS Sun,S.Q., Jiang,C.G., Lin,Y., Jin,Y.L. and Huang,P.L. TITLE Enhanced T cell immunity by B7-H4 downregulation in nonsmall-cell lung cancer cell lines JOURNAL J. Int. Med. Res. 40 (2), 497-506 (2012) PUBMED 22613410 REMARK GeneRIF: study concludes B7-H4 negatively regulates T cell-mediated antitumour immunity in nonsmall-cell lung cancer REFERENCE 6 (bases 1 to 2652) AUTHORS Clark,H.F., Gurney,A.L., Abaya,E., Baker,K., Baldwin,D., Brush,J., Chen,J., Chow,B., Chui,C., Crowley,C., Currell,B., Deuel,B., Dowd,P., Eaton,D., Foster,J., Grimaldi,C., Gu,Q., Hass,P.E., Heldens,S., Huang,A., Kim,H.S., Klimowski,L., Jin,Y., Johnson,S., Lee,J., Lewis,L., Liao,D., Mark,M., Robbie,E., Sanchez,C., Schoenfeld,J., Seshagiri,S., Simmons,L., Singh,J., Smith,V., Stinson,J., Vagts,A., Vandlen,R., Watanabe,C., Wieand,D., Woods,K., Xie,M.H., Yansura,D., Yi,S., Yu,G., Yuan,J., Zhang,M., Zhang,Z., Goddard,A., Wood,W.I., Godowski,P. and Gray,A. TITLE The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment JOURNAL Genome Res. 13 (10), 2265-2270 (2003) PUBMED 12975309 REMARK Erratum:[Genome Res. 2003 Dec;13(12):2759] REFERENCE 7 (bases 1 to 2652) AUTHORS Zang,X., Loke,P., Kim,J., Murphy,K., Waitz,R. and Allison,J.P. TITLE B7x: a widely expressed B7 family member that inhibits T cell activation JOURNAL Proc. Natl. Acad. Sci. U.S.A. 100 (18), 10388-10392 (2003) PUBMED 12920180 REFERENCE 8 (bases 1 to 2652) AUTHORS Watanabe,N., Gavrieli,M., Sedy,J.R., Yang,J., Fallarino,F., Loftin,S.K., Hurchla,M.A., Zimmerman,N., Sim,J., Zang,X., Murphy,T.L., Russell,J.H., Allison,J.P. and Murphy,K.M. TITLE BTLA is a lymphocyte inhibitory receptor with similarities to CTLA-4 and PD-1 JOURNAL Nat. Immunol. 4 (7), 670-679 (2003) PUBMED 12796776 REFERENCE 9 (bases 1 to 2652) AUTHORS Prasad,D.V., Richards,S., Mai,X.M. and Dong,C. TITLE B7S1, a novel B7 family member that negatively regulates T cell activation JOURNAL Immunity 18 (6), 863-873 (2003) PUBMED 12818166 REMARK GeneRIF: Negative regulator of T cell activation. (B7S1) REFERENCE 10 (bases 1 to 2652) AUTHORS Sica,G.L., Choi,I.H., Zhu,G., Tamada,K., Wang,S.D., Tamura,H., Chapoval,A.I., Flies,D.B., Bajorath,J. and Chen,L. TITLE B7-H4, a molecule of the B7 family, negatively regulates T cell immunity JOURNAL Immunity 18 (6), 849-861 (2003) PUBMED 12818165 REMARK GeneRIF: May participate in negative regulation of cell-mediated immunity in peripheral tissues COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DC347131.1, DB198367.1, AY280972.1, CN259811.1, AL391476.20 and AI686571.1. On Dec 8, 2011 this sequence version replaced gi:99028880. Summary: This gene encodes a protein belonging to the B7 costimulatory protein family. Proteins in this family are present on the surface of antigen-presenting cells and interact with ligand bound to receptors on the surface of T cells. Studies have shown that high levels of the encoded protein has been correlated with tumor progression. A pseudogene of this gene is located on chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]. Transcript Variant: This variant (1) encodes the longest protein (isoform 1). Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AY358352.1, AK026071.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084, ERS025088 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-33 DC347131.1 1-33 34-105 DB198367.1 1-72 106-954 AY280972.1 1-849 955-1087 CN259811.1 523-655 1088-2205 AL391476.20 81082-82199 c 2206-2652 AI686571.1 1-447 c FEATURES Location/Qualifiers source 1..2652 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="1" /map="1p13.1" gene 1..2652 /gene="VTCN1" /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291; RP11-229A19.4; VCTN1" /note="V-set domain containing T cell activation inhibitor 1" /db_xref="GeneID:79679" /db_xref="HGNC:28873" /db_xref="MIM:608162" exon 1..137 /gene="VTCN1" /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291; RP11-229A19.4; VCTN1" /inference="alignment:Splign:1.39.8" STS 75..990 /gene="VTCN1" /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291; RP11-229A19.4; VCTN1" /db_xref="UniSTS:481957" CDS 106..954 /gene="VTCN1" /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291; RP11-229A19.4; VCTN1" /note="isoform 1 precursor is encoded by transcript variant 1; B7 family member, H4; immune costimulatory protein B7-H4; V-set domain-containing T-cell activation inhibitor 1; T cell costimulatory molecule B7x; B7 superfamily member 1; T-cell costimulatory molecule B7x" /codon_start=1 /product="V-set domain-containing T-cell activation inhibitor 1 isoform 1 precursor" /protein_id="NP_078902.2" /db_xref="GI:99028881" /db_xref="CCDS:CCDS894.1" /db_xref="GeneID:79679" /db_xref="HGNC:28873" /db_xref="MIM:608162" /translation="
MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
" sig_peptide 106..177 /gene="VTCN1" /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291; RP11-229A19.4; VCTN1" /inference="non-experimental evidence, no additional details recorded" /note="Potential; propagated from UniProtKB/Swiss-Prot (Q7Z7D3.1)" mat_peptide 178..951 /gene="VTCN1" /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291; RP11-229A19.4; VCTN1" /product="V-set domain-containing T-cell activation inhibitor 1" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q7Z7D3.1)" misc_feature 211..510 /gene="VTCN1" /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291; RP11-229A19.4; VCTN1" /note="Immunoglobulin V-set domain; Region: V-set; pfam07686" /db_xref="CDD:203725" misc_feature 250..543 /gene="VTCN1" /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291; RP11-229A19.4; VCTN1" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:213125" misc_feature 883..945 /gene="VTCN1" /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291; RP11-229A19.4; VCTN1" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q7Z7D3.1); transmembrane region" exon 138..202 /gene="VTCN1" /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291; RP11-229A19.4; VCTN1" /inference="alignment:Splign:1.39.8" exon 203..550 /gene="VTCN1" /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291; RP11-229A19.4; VCTN1" /inference="alignment:Splign:1.39.8" exon 551..829 /gene="VTCN1" /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291; RP11-229A19.4; VCTN1" /inference="alignment:Splign:1.39.8" exon 830..999 /gene="VTCN1" /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291; RP11-229A19.4; VCTN1" /inference="alignment:Splign:1.39.8" exon 1000..2638 /gene="VTCN1" /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291; RP11-229A19.4; VCTN1" /inference="alignment:Splign:1.39.8" variation 1722 /gene="VTCN1" /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291; RP11-229A19.4; VCTN1" /replace="a" /replace="t" /db_xref="dbSNP:1937956" variation 2355 /gene="VTCN1" /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291; RP11-229A19.4; VCTN1" /replace="g" /replace="t" /db_xref="dbSNP:13505" STS 2448..2572 /gene="VTCN1" /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291; RP11-229A19.4; VCTN1" /standard_name="SHGC-75394" /db_xref="UniSTS:7059" ORIGIN
acactatttaaggccaatacacgggagctggttgtgagtcaccaaggaaggcagcggcagctccactcagccagtacccagatacgctgggaaccttccccagccatggcttccctggggcagatcctcttctggagcataattagcatcatcattattctggctggagcaattgcactcatcattggctttggtatttcagggagacactccatcacagtcactactgtcgcctcagctgggaacattggggaggatggaatcctgagctgcacttttgaacctgacatcaaactttctgatatcgtgatacaatggctgaaggaaggtgttttaggcttggtccatgagttcaaagaaggcaaagatgagctgtcggagcaggatgaaatgttcagaggccggacagcagtgtttgctgatcaagtgatagttggcaatgcctctttgcggctgaaaaacgtgcaactcacagatgctggcacctacaaatgttatatcatcacttctaaaggcaaggggaatgctaaccttgagtataaaactggagccttcagcatgccggaagtgaatgtggactataatgccagctcagagaccttgcggtgtgaggctccccgatggttcccccagcccacagtggtctgggcatcccaagttgaccagggagccaacttctcggaagtctccaataccagctttgagctgaactctgagaatgtgaccatgaaggttgtgtctgtgctctacaatgttacgatcaacaacacatactcctgtatgattgaaaatgacattgccaaagcaacaggggatatcaaagtgacagaatcggagatcaaaaggcggagtcacctacagctgctaaactcaaaggcttctctgtgtgtctcttctttctttgccatcagctgggcacttctgcctctcagcccttacctgatgctaaaataatgtgcctcggccacaaaaaagcatgcaaagtcattgttacaacagggatctacagaactatttcaccaccagatatgacctagttttatatttctgggaggaaatgaattcatatctagaagtctggagtgagcaaacaagagcaagaaacaaaaagaagccaaaagcagaaggctccaatatgaacaagataaatctatcttcaaagacatattagaagttgggaaaataattcatgtgaactagacaagtgtgttaagagtgataagtaaaatgcacgtggagacaagtgcatccccagatctcagggacctccccctgcctgtcacctggggagtgagaggacaggatagtgcatgttctttgtctctgaatttttagttatatgtgctgtaatgttgctctgaggaagcccctggaaagtctatcccaacatatccacatcttatattccacaaattaagctgtagtatgtaccctaagacgctgctaattgactgccacttcgcaactcaggggcggctgcattttagtaatgggtcaaatgattcactttttatgatgcttccaaaggtgccttggcttctcttcccaactgacaaatgccaaagttgagaaaaatgatcataattttagcataaacagagcagtcggcgacaccgattttataaataaactgagcaccttctttttaaacaaacaaatgcgggtttatttctcagatgatgttcatccgtgaatggtccagggaaggacctttcaccttgtctatatggcattatgtcatcacaagctctgaggcttctcctttccatcctgcgtggacagctaagacctcagttttcaatagcatctagagcagtgggactcagctggggtgatttcgccccccatctccgggggaatgtctgaagacaattttggttacctcaatgagggagtggaggaggatacagtgctactaccaactagtggatagaggccagggatgctgctcaacctcctaccatgtacaggacgtctccccattacaactacccaatccgaagtgtcaactgtgtcagggctaagaaaccctggttttgagtagaaaagggcctggaaagaggggagccaacaaatctgtctgcttcctcacattagtcattggcaaataagcattctgtctctttggctgctgcctcagcacagagagccagaactctatcgggcaccaggataacatctctcagtgaacagagttgacaaggcctatgggaaatgcctgatgggattatcttcagcttgttgagcttctaagtttctttcccttcattctaccctgcaagccaagttctgtaagagaaatgcctgagttctagctcaggttttcttactctgaatttagatctccagaccctgcctggccacaattcaaattaaggcaacaaacatataccttccatgaagcacacacagacttttgaaagcaaggacaatgactgcttgaattgaggccttgaggaatgaagctttgaaggaaaagaatactttgtttccagcccccttcccacactcttcatgtgttaaccactgccttcctggaccttggagccacggtgactgtattacatgttgttatagaaaactgattttagagttctgatcgttcaagagaatgattaaatatacatttcctacaccaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:79679 -> Molecular function: GO:0005102 [receptor binding] evidence: IEA GeneID:79679 -> Biological process: GO:0001562 [response to protozoan] evidence: IEA GeneID:79679 -> Biological process: GO:0050868 [negative regulation of T cell activation] evidence: IEA GeneID:79679 -> Biological process: GO:0072602 [interleukin-4 secretion] evidence: IEA GeneID:79679 -> Biological process: GO:0072643 [interferon-gamma secretion] evidence: IEA GeneID:79679 -> Cellular component: GO:0009897 [external side of plasma membrane] evidence: IEA GeneID:79679 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.