Home |
Help |
Advanced search
2024-04-27 14:11:26, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_024605 3073 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens Rho GTPase activating protein 10 (ARHGAP10), mRNA.
ACCESSION NM_024605 XM_496719
VERSION NM_024605.3 GI:50843947
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 3073)
AUTHORS Kennedy,R.B., Ovsyannikova,I.G., Pankratz,V.S., Haralambieva,I.H.,
Vierkant,R.A. and Poland,G.A.
TITLE Genome-wide analysis of polymorphisms associated with cytokine
responses in smallpox vaccine recipients
JOURNAL Hum. Genet. 131 (9), 1403-1421 (2012)
PUBMED 22610502
REFERENCE 2 (bases 1 to 3073)
AUTHORS Azzato,E.M., Pharoah,P.D., Harrington,P., Easton,D.F.,
Greenberg,D., Caporaso,N.E., Chanock,S.J., Hoover,R.N., Thomas,G.,
Hunter,D.J. and Kraft,P.
TITLE A genome-wide association study of prognosis in breast cancer
JOURNAL Cancer Epidemiol. Biomarkers Prev. 19 (4), 1140-1143 (2010)
PUBMED 20332263
REMARK GeneRIF: Observational study and genome-wide association study of
gene-disease association. (HuGE Navigator)
REFERENCE 3 (bases 1 to 3073)
AUTHORS Lind,P.A., Macgregor,S., Vink,J.M., Pergadia,M.L., Hansell,N.K., de
Moor,M.H., Smit,A.B., Hottenga,J.J., Richter,M.M., Heath,A.C.,
Martin,N.G., Willemsen,G., de Geus,E.J., Vogelzangs,N.,
Penninx,B.W., Whitfield,J.B., Montgomery,G.W., Boomsma,D.I. and
Madden,P.A.
TITLE A genomewide association study of nicotine and alcohol dependence
in Australian and Dutch populations
JOURNAL Twin Res Hum Genet 13 (1), 10-29 (2010)
PUBMED 20158304
REMARK GeneRIF: In the Australian GWAS, one SNP achieved genomewide
significance (p < 5 x 10(-8)) for ND (rs964170 in ARHGAP10 on
chromosome 4, p = 4.43 x 10(-8)).
REFERENCE 4 (bases 1 to 3073)
AUTHORS Takefuji,M., Asano,H., Mori,K., Amano,M., Kato,K., Watanabe,T.,
Morita,Y., Katsumi,A., Itoh,T., Takenawa,T., Hirashiki,A.,
Izawa,H., Nagata,K., Hirayama,H., Takatsu,F., Naoe,T., Yokota,M.
and Kaibuchi,K.
TITLE Mutation of ARHGAP9 in patients with coronary spastic angina
JOURNAL J. Hum. Genet. 55 (1), 42-49 (2010)
PUBMED 19911011
REMARK GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
REFERENCE 5 (bases 1 to 3073)
AUTHORS Marroni,F., Pfeufer,A., Aulchenko,Y.S., Franklin,C.S., Isaacs,A.,
Pichler,I., Wild,S.H., Oostra,B.A., Wright,A.F., Campbell,H.,
Witteman,J.C., Kaab,S., Hicks,A.A., Gyllensten,U., Rudan,I.,
Meitinger,T., Pattaro,C., van Duijn,C.M., Wilson,J.F. and
Pramstaller,P.P.
CONSRTM EUROSPAN Consortium
TITLE A genome-wide association scan of RR and QT interval duration in 3
European genetically isolated populations: the EUROSPAN project
JOURNAL Circ Cardiovasc Genet 2 (4), 322-328 (2009)
PUBMED 20031603
REFERENCE 6 (bases 1 to 3073)
AUTHORS Koeppel,M.A., McCarthy,C.C., Moertl,E. and Jakobi,R.
TITLE Identification and characterization of PS-GAP as a novel regulator
of caspase-activated PAK-2
JOURNAL J. Biol. Chem. 279 (51), 53653-53664 (2004)
PUBMED 15471851
REMARK GeneRIF: PS-GAP is a novel regulator of caspase-activated PAK-2
REFERENCE 7 (bases 1 to 3073)
AUTHORS Shibata,H., Oishi,K., Yamagiwa,A., Matsumoto,M., Mukai,H. and
Ono,Y.
TITLE PKNbeta interacts with the SH3 domains of Graf and a novel Graf
related protein, Graf2, which are GTPase activating proteins for
Rho family
JOURNAL J. Biochem. 130 (1), 23-31 (2001)
PUBMED 11432776
REFERENCE 8 (bases 1 to 3073)
AUTHORS Lancaster,C.A., Taylor-Harris,P.M., Self,A.J., Brill,S., van
Erp,H.E. and Hall,A.
TITLE Characterization of rhoGAP. A GTPase-activating protein for
rho-related small GTPases
JOURNAL J. Biol. Chem. 269 (2), 1137-1142 (1994)
PUBMED 8288572
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AK123785.1 and BC011920.2.
On or before Aug 30, 2004 this sequence version replaced
gi:51464233, gi:31377700.
##Evidence-Data-START##
Transcript exon combination :: BC128055.1, BC126899.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025083 [ECO:0000348]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-486 AK123785.1 240-725
487-2380 BC011920.2 17-1910
2381-3073 BC011920.2 1912-2604
FEATURES Location/Qualifiers
source 1..3073
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="4"
/map="4q31.23"
gene 1..3073
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/note="Rho GTPase activating protein 10"
/db_xref="GeneID:79658"
/db_xref="HGNC:26099"
/db_xref="MIM:609746"
CDS 1..2361
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/note="graf-related protein 2; rho-type GTPase-activating
protein 10; GTPase regulator associated with focal
adhesion kinase 2"
/codon_start=1
/product="rho GTPase-activating protein 10"
/protein_id="NP_078881.3"
/db_xref="GI:50843948"
/db_xref="CCDS:CCDS34075.1"
/db_xref="GeneID:79658"
/db_xref="HGNC:26099"
/db_xref="MIM:609746"
/translation="
MGLQPLEFSDCYLDSPWFRERIRAHEAELERTNKFIKELIKDGKNLIAATKSLSVAQRKFAHSLRDFKFEFIGDAVTDDERCIDASLREFSNFLKNLEEQREIMALSVTETLIKPLEKFRKEQLGAVKEEKKKFDKETEKNYSLIDKHLNLSAKKKDSHLQEADIQVEQNRQHFYELSLEYVCKLQEIQERKKFEFVEPMLSFFQGMFTFYHQGHELAKDFNHYKMELQINIQNTRNRFEGTRSEVEELMNKIRQNPKDHKRASQFTAEGYLYVQEKRPAPFGSSWVKHYCMYRKAAKKFNMIPFEHRSGGKLGDGEVFFLKECTKRHTDSIDRRFCFDIEAADRPGVSLTMQAFSEEERKQWLEALGGKEALSHSFNTAIIPRPEGNAQLDKMGFTIIRKCISAVETRGINDQGLYRVVGVSSKVQRLLSMLMDVKTCNEVDLENSADWEVKTITSALKQYLRSLPEPLMTYELHGDFIVPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVANLGVVFGPTLMRPQEETVAALMDLKFQNIVVEILIENHEKIFRTPPDTTFPEPTCLSASPPNAPPRQSKRQGQRTKRPVAVYNLCLELEDGDNPYPSKEDTPTSSLDSLSSPSPVTTAVPGPPGPDKNHLLADGGSFGDWASTIPGQTRSSMVQWLNPQSPTTTSSNSAVTPLSPGSSPFPFSPPATVADKPPESIRSRKARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWLEGTLNGKRGLIPQNYVKLL
"
misc_feature 55..675
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/note="The Bin/Amphiphysin/Rvs (BAR) domain of GTPase
Regulator Associated with Focal adhesion 2; Region:
BAR_GRAF2; cd07635"
/db_xref="CDD:153319"
misc_feature order(82..84,91..96,106..108,112..117,124..129,133..138,
145..150,154..159,166..171,175..180,187..189,268..270,
277..282,556..558,565..570,574..576,589..591,598..603,
607..612,622..627,634..639,643..648,652..657,661..666)
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/note="dimer interface [polypeptide binding]; other site"
/db_xref="CDD:153319"
misc_feature 805..1110
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/note="Pleckstrin homology-like domain; Region: PH-like;
cl00273"
/db_xref="CDD:206947"
misc_feature order(805..825,859..879,886..906,967..978,1009..1023,
1042..1044,1048..1059,1084..1110)
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/note="PH-like core; other site"
/db_xref="CDD:176275"
misc_feature 1099..1707
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/note="RhoGAP_Graf: GTPase-activator protein (GAP) domain
for Rho-like GTPases found in GRAF (GTPase regulator
associated with focal adhesion kinase); Graf is a
multi-domain protein, containing SH3 and PH domains, that
binds focal adhesion kinase and influences...; Region:
RhoGAP_Graf; cd04374"
/db_xref="CDD:63843"
misc_feature 1192..1710
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/note="GTPase-activator protein for Rho-like GTPases;
Region: RhoGAP; smart00324"
/db_xref="CDD:197653"
misc_feature order(1252..1254,1378..1380,1390..1392,1597..1599,
1606..1611,1678..1680)
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/note="putative GTPase interaction site [polypeptide
binding]; other site"
/db_xref="CDD:63843"
misc_feature 1252..1254
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/note="catalytic residue [active]"
/db_xref="CDD:63843"
misc_feature 2194..2355
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/note="Src Homology 3 domain of GTPase Regulator
Associated with Focal adhesion kinase 2; Region:
SH3_GRAF2; cd12065"
/db_xref="CDD:212998"
misc_feature order(2209..2211,2215..2217,2224..2226,2236..2238,
2293..2298,2335..2337,2341..2346)
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/note="peptide ligand binding site [polypeptide binding];
other site"
/db_xref="CDD:212998"
exon 1..154
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/inference="alignment:Splign:1.39.8"
variation 117
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="g"
/db_xref="dbSNP:200809778"
variation 118
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:143394176"
variation 127
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="g"
/replace="t"
/db_xref="dbSNP:368342959"
exon 155..250
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/inference="alignment:Splign:1.39.8"
variation 173
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:201829552"
variation 184
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:77723329"
variation 196
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:147148587"
variation 204
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:148213515"
variation 247
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:369109767"
exon 251..312
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/inference="alignment:Splign:1.39.8"
variation 276
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="g"
/replace="t"
/db_xref="dbSNP:141207224"
variation 292
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:202042143"
variation 300
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:199864383"
exon 313..384
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/inference="alignment:Splign:1.39.8"
variation 321
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:150761428"
variation 339
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:139143454"
variation 366
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:144122508"
variation 372
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="g"
/replace="t"
/db_xref="dbSNP:370942760"
exon 385..486
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/inference="alignment:Splign:1.39.8"
variation 396
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="g"
/replace="t"
/db_xref="dbSNP:376938461"
variation 411
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:201761277"
variation 428
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:146024674"
variation 435
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="t"
/db_xref="dbSNP:371613697"
variation 475
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:139990305"
exon 487..597
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/inference="alignment:Splign:1.39.8"
variation 512
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:370541915"
variation 545
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:113916624"
exon 598..702
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/inference="alignment:Splign:1.39.8"
variation 618
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:143552684"
variation 640
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:199963512"
variation 658
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:4463051"
variation 665
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:145720035"
variation 677
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:143731526"
exon 703..832
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/inference="alignment:Splign:1.39.8"
variation 706
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="g"
/db_xref="dbSNP:142876032"
variation 729
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:113611599"
variation 744
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:371591903"
variation 769
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="c"
/db_xref="dbSNP:142531496"
variation 804
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:374150548"
exon 833..939
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/inference="alignment:Splign:1.39.8"
variation 874
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:375034312"
variation 881
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:146827185"
variation 882
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:139330893"
variation 902
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:141883900"
variation 904
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:200972105"
exon 940..1034
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/inference="alignment:Splign:1.39.8"
variation 946
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:138388284"
variation 977
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:201421446"
variation 978
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:61758694"
exon 1035..1116
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/inference="alignment:Splign:1.39.8"
variation 1037
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="c"
/db_xref="dbSNP:149405506"
variation 1040
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:374709295"
variation 1041
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:61748165"
variation 1046
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:200935817"
variation 1068
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:371799366"
variation 1096
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:148015211"
exon 1117..1162
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/inference="alignment:Splign:1.39.8"
exon 1163..1228
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/inference="alignment:Splign:1.39.8"
variation 1164
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:371096735"
variation 1183
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:115753644"
variation 1192
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:373428584"
variation 1194
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="g"
/replace="t"
/db_xref="dbSNP:147640829"
variation 1215
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:140550063"
variation 1216
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:139956461"
exon 1229..1303
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/inference="alignment:Splign:1.39.8"
variation 1248
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:201010197"
variation 1259
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="g"
/replace="t"
/db_xref="dbSNP:199972892"
exon 1304..1391
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/inference="alignment:Splign:1.39.8"
variation 1327
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:143486090"
exon 1392..1450
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/inference="alignment:Splign:1.39.8"
variation 1410
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:150813807"
variation 1418
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:369503939"
exon 1451..1556
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/inference="alignment:Splign:1.39.8"
variation 1455
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:372408519"
variation 1461
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:17024215"
variation 1467
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="c"
/db_xref="dbSNP:149994997"
variation 1481
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:117523998"
variation 1482
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:138656417"
variation 1517
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:182170148"
variation 1553
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="c"
/db_xref="dbSNP:375188932"
variation 1554
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:371005513"
exon 1557..1716
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/inference="alignment:Splign:1.39.8"
variation 1573
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="c"
/db_xref="dbSNP:181771226"
variation 1589
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:34051206"
variation 1594
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:370860233"
variation 1605
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:375266770"
variation 1651
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:145234400"
variation 1704
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:367827782"
variation 1709
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:370340384"
variation 1713
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:186937635"
exon 1717..1867
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/inference="alignment:Splign:1.39.8"
variation 1723
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:201271675"
variation 1724
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:372199389"
variation 1728
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:376580228"
variation 1730
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:200329568"
variation 1738
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:183257688"
variation 1741
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:142468491"
variation 1754
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:187296312"
variation 1762
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:144786855"
variation 1770
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:35975487"
variation 1774
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:376059450"
variation 1776
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:200847076"
variation 1784
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="g"
/db_xref="dbSNP:141816044"
variation 1799
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:139150580"
variation 1810
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:372240163"
variation 1836
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:61748167"
variation 1842
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:115152490"
variation 1844
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:150306219"
variation 1853
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:372576984"
variation 1861
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="g"
/db_xref="dbSNP:112034189"
variation 1863
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="c"
/db_xref="dbSNP:61758693"
variation 1865
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:190936896"
exon 1868..2027
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/inference="alignment:Splign:1.39.8"
variation 1874
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:142479942"
variation 1905
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:139083187"
variation 1908
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:11725737"
variation 1932
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:374020706"
variation 1938
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:149853025"
variation 1939
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:200578124"
variation 1948
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="g"
/db_xref="dbSNP:377561565"
variation 1959
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:200880348"
variation 1974
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="g"
/db_xref="dbSNP:149308358"
variation 1997
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:144604709"
variation 2003
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:148488452"
variation 2026
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:74523651"
exon 2028..2180
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/inference="alignment:Splign:1.39.8"
variation 2034
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:144731909"
STS 2043..2182
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/standard_name="RH48780"
/db_xref="UniSTS:18749"
variation 2046
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:200687367"
variation 2050
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:2276932"
variation 2058
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:199848122"
variation 2060
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="g"
/db_xref="dbSNP:202211834"
variation 2070
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="c"
/db_xref="dbSNP:143292020"
variation 2080
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:150043333"
variation 2100
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:145399420"
variation 2107
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:116143842"
variation 2121
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:200889352"
variation 2122
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="g"
/db_xref="dbSNP:368707168"
variation 2126
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:143431621"
variation 2127
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:199978457"
variation 2163
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:146423921"
variation 2179..2180
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace=""
/replace="a"
/db_xref="dbSNP:34854324"
exon 2181..2272
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/inference="alignment:Splign:1.39.8"
variation 2186
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:368070329"
variation 2191
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:200388255"
variation 2192
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:140860373"
variation 2206
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:146780598"
variation 2207
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:138625638"
variation 2213
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:141244949"
variation 2234
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:188978261"
variation 2235
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:374794611"
exon 2273..3056
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/inference="alignment:Splign:1.39.8"
variation 2290
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="c"
/db_xref="dbSNP:202046229"
variation 2301
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="c"
/db_xref="dbSNP:150358309"
variation 2337
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="t"
/db_xref="dbSNP:374207710"
variation 2346
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:200184056"
variation 2371
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:201550716"
variation 2373
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="t"
/db_xref="dbSNP:200581454"
variation 2378
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="c"
/db_xref="dbSNP:199526928"
variation 2393
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="c"
/db_xref="dbSNP:369338341"
variation 2508
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:73853720"
variation 2532
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:183954044"
variation 2586
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="a"
/replace="g"
/db_xref="dbSNP:375164164"
variation 2670
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:111753472"
variation 2685
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:367905669"
variation 2832
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:370442649"
STS 2847..2967
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/standard_name="STS-R60782"
/db_xref="UniSTS:49168"
variation 2894
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:141912202"
variation 2952
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="t"
/db_xref="dbSNP:374067869"
variation 2986
/gene="ARHGAP10"
/gene_synonym="GRAF2; PS-GAP; PSGAP"
/replace="c"
/replace="g"
/db_xref="dbSNP:9724"
ORIGIN
atggggctgcagcccctggagttcagcgactgctacctcgacagcccgtggttccgggagaggatccgcgctcacgaagcggaactcgagaggaccaacaagttcatcaaagagctcattaaggacgggaagaacctcatcgctgcgacgaaaagtctgtcagtggcccagcggaagtttgctcattcactcagagactttaagtttgagtttatcggtgatgctgtgacagatgatgaacgatgcatagatgcttccttacgtgaattttcaaattttttgaagaatctggaggaacagagagaaattatggcattaagtgtaactgaaaccctgattaaacccttggaaaaattcagaaaagagcaacttggagctgtaaaggaagaaaaaaagaagtttgacaaagagacagaaaagaattatagtctaattgataaacatttgaatttatcagcaaaaaagaaagactcacatttacaagaggcagatatccaagtagagcagaaccggcaacacttctatgaactgtctctcgagtatgtgtgtaagctgcaggaaatccaagaaagaaagaagtttgagtttgtggaacctatgctgtcattttttcaggggatgtttaccttctatcatcagggccatgaacttgccaaagacttcaatcactacaaaatggaactacagatcaacattcagaatacacggaatcgatttgaaggaacaaggtcagaagtggaagagctcatgaacaaaatcagacagaatcccaaggaccacaaacgagcaagtcagtttacagccgaaggctacctgtatgtccaggaaaaaaggcctgctccgtttggttccagttgggtcaaacactattgcatgtatcgaaaagcagcaaagaagttcaacatgatcccatttgagcacagatctggagggaaacttggggacggagaggtgttctttttgaaagaatgtaccaagaggcatactgactccattgacagaaggttttgttttgacatagaagctgctgatcggcctggcgtttccttgaccatgcaggcattttccgaagaggaaaggaagcagtggttggaagctctgggtggaaaggaagctctgtcccatagttttaatacagccatcatcccaagaccagaaggaaatgcacagttggataagatggggttcacaattatcagaaaatgcatcagtgccgttgaaacacgaggtataaatgaccaaggattgtacagagttgtgggggtgagttcaaaggtccagagacttctgagtatgttgatggatgtaaaaacatgcaatgaggtggacctggagaattctgcagattgggaagtgaagacaataacaagtgccttgaaacagtatttgaggagtcttccagagcctctcatgacctatgagttacatggagatttcattgttccagccaaaagcggcagcccagaatctcgtgttaatgcgatccatttcttggtacacaaactgccagagaagaataaagagatgttggatattttggtgaaacacttaacaaatgtttcaaatcactccaagcagaacctgatgactgtggcaaacttaggagtggtgtttggaccaactctgatgaggccacaggaagaaactgtcgctgccctcatggacttgaagtttcagaatattgttgtggaaatcttaattgaaaaccatgaaaagatttttcggacgccgcccgatactacattccctgagcccacctgcctgtcagcatcacccccaaatgcgccaccaaggcagtcgaagagacaaggccagagaaccaagaggcccgtggccgtctacaatctttgtctggagctggaagatggtgacaatccttacccttccaaggaggacacccctaccagcagtctggactcactttcctccccgtctcccgtgactacagctgtccctgggcctcctggaccagacaaaaaccaccttctggcagatggagggagctttggagactgggcatccactatcccaggccagacccgatcgtctatggtccagtggcttaacccacagtctccaaccacaacaagctccaactcagctgtgacacctctttcacccgggtcgtcccctttccccttttctcctcctgctactgtagcggacaagccacctgaaagcatccgcagtcggaaggctcgagccgtgtatccgtgtgaagcagaacacagctcggaattatcttttgaaataggagcaatttttgaggatgtacaaacctccagggaacctggctggctagaagggactctgaacggcaagagggggctgattccacagaactacgtcaagctgctgtagctcctggcctcagagcccctgctgaccctggcacccagggacctgcctgggggcagagagctgtcttcctcctccgaggctctgggctgcacccacaggtacctccacacttgggagttaccatcatcacagtcagccctgggggtggggggtggtgggcagggatgggacgcaccacacagaactgtgattgtggatcaggaggggaatgtcaggattcgcaaaatggacttttcatttgtcaagtattgggacttgtgatttttaattatccagcatatagaatgagagggagggcagccttctgccacctgtgtcgcctccactggcagtcacgccaccagagccaccctggctccctctcctccctgagcacctgctgctgcgattttaaagggaactgtactactcgcagtgataggtttgcagagtgtgtgcttggctgtggcagcctagcttggagaagctgctgttggtgcaagggagatggtctcaagtcagagggaagcagagacgcgcgtctcaagcctgcccttcctagacggccacctgcaggaccccacactcactgcactggcagcgtgcactggcgtatttgtaacaggcttctcggtgctcctcacccgtgtgctgttttccaaacaccacctttttgcctcaaggtctctgtaaatgaaataaactgtaatttactaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:79658 -> Molecular function: GO:0005100 [Rho GTPase activator activity] evidence: IEA
GeneID:79658 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:79658 -> Molecular function: GO:0005543 [phospholipid binding] evidence: IEA
GeneID:79658 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:79658 -> Biological process: GO:0007010 [cytoskeleton organization] evidence: IEA
GeneID:79658 -> Biological process: GO:0007264 [small GTPase mediated signal transduction] evidence: TAS
GeneID:79658 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: TAS
GeneID:79658 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IEA
GeneID:79658 -> Biological process: GO:0051056 [regulation of small GTPase mediated signal transduction] evidence: TAS
GeneID:79658 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:79658 -> Cellular component: GO:0005886 [plasma membrane] evidence: IEA
GeneID:79658 -> Cellular component: GO:0048471 [perinuclear region of cytoplasm] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.