Home |
Help |
Advanced search
2024-04-20 10:02:03, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_024569 4923 bp mRNA linear PRI 14-MAY-2013
DEFINITION Homo sapiens myelin protein zero-like 1 (MPZL1), transcript variant
2, mRNA.
ACCESSION NM_024569
VERSION NM_024569.4 GI:226054556
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 4923)
AUTHORS Cummings,A.C., Jiang,L., Velez Edwards,D.R., McCauley,J.L.,
Laux,R., McFarland,L.L., Fuzzell,D., Knebusch,C., Caywood,L.,
Reinhart-Mercer,L., Nations,L., Gilbert,J.R., Konidari,I.,
Tramontana,M., Cuccaro,M.L., Scott,W.K., Pericak-Vance,M.A. and
Haines,J.L.
TITLE Genome-wide association and linkage study in the Amish detects a
novel candidate late-onset Alzheimer disease gene
JOURNAL Ann. Hum. Genet. 76 (5), 342-351 (2012)
PUBMED 22881374
REFERENCE 2 (bases 1 to 4923)
AUTHORS Gallardo,E., Garcia,A., Ramon,C., Maravi,E., Infante,J., Gaston,I.,
Alonso,A., Combarros,O., De Jonghe,P. and Berciano,J.
TITLE Charcot-Marie-Tooth disease type 2J with MPZ Thr124Met mutation:
clinico-electrophysiological and MRI study of a family
JOURNAL J. Neurol. 256 (12), 2061-2071 (2009)
PUBMED 19629567
REMARK GeneRIF: Clinico-electrophysiological features and MRI findings are
described in leg musculature from three patients belonging to a
CMT2J pedigree due to MPZ Thr124Met mutation.
REFERENCE 3 (bases 1 to 4923)
AUTHORS Ehret,G.B., O'Connor,A.A., Weder,A., Cooper,R.S. and Chakravarti,A.
TITLE Follow-up of a major linkage peak on chromosome 1 reveals
suggestive QTLs associated with essential hypertension: GenNet
study
JOURNAL Eur. J. Hum. Genet. 17 (12), 1650-1657 (2009)
PUBMED 19536175
REMARK GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
REFERENCE 4 (bases 1 to 4923)
AUTHORS Cheung,C.L., Chan,B.Y., Chan,V., Ikegawa,S., Kou,I., Ngai,H.,
Smith,D., Luk,K.D., Huang,Q.Y., Mori,S., Sham,P.C. and Kung,A.W.
TITLE Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible
genetic association with bone mineral density variation
JOURNAL Hum. Mol. Genet. 18 (4), 679-687 (2009)
PUBMED 19064610
REMARK GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
REFERENCE 5 (bases 1 to 4923)
AUTHORS Kusano,K., Thomas,T.N. and Fujiwara,K.
TITLE Phosphorylation and localization of protein-zero related (PZR) in
cultured endothelial cells
JOURNAL Endothelium 15 (3), 127-136 (2008)
PUBMED 18568953
REMARK GeneRIF: Phosphorylation and localization of PZR in cultured
endothelial cells is reported.
REFERENCE 6 (bases 1 to 4923)
AUTHORS Wistow,G., Bernstein,S.L., Wyatt,M.K., Fariss,R.N., Behal,A.,
Touchman,J.W., Bouffard,G., Smith,D. and Peterson,K.
TITLE Expressed sequence tag analysis of human RPE/choroid for the
NEIBank Project: over 6000 non-redundant transcripts, novel genes
and splice variants
JOURNAL Mol. Vis. 8, 205-220 (2002)
PUBMED 12107410
REMARK Publication Status: Online-Only
REFERENCE 7 (bases 1 to 4923)
AUTHORS Zhao,R., Guerrah,A., Tang,H. and Zhao,Z.J.
TITLE Cell surface glycoprotein PZR is a major mediator of concanavalin
A-induced cell signaling
JOURNAL J. Biol. Chem. 277 (10), 7882-7888 (2002)
PUBMED 11751924
REMARK GeneRIF: PZR is a major receptor of ConA and has an important role
in cell signaling via c-Src. Considering the various biological
activities of ConA, the study of PZR may have major therapeutic
implications
REFERENCE 8 (bases 1 to 4923)
AUTHORS Zhao,R. and Zhao,Z.J.
TITLE Dissecting the interaction of SHP-2 with PZR, an immunoglobulin
family protein containing immunoreceptor tyrosine-based inhibitory
motifs
JOURNAL J. Biol. Chem. 275 (8), 5453-5459 (2000)
PUBMED 10681522
REFERENCE 9 (bases 1 to 4923)
AUTHORS Tang,D.S., Yu,K.P., Tang,X.X., Zhang,H.L., Pan,Q., Dai,H.P. and
Xia,J.H.
TITLE Cloning of Human Myelin Protein Zero-like Genes by Bioinformatics
Strategy
JOURNAL Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao 32 (4), 364-368 (2000)
PUBMED 12075424
REFERENCE 10 (bases 1 to 4923)
AUTHORS Zhao,Z.J. and Zhao,R.
TITLE Purification and cloning of PZR, a binding protein and putative
physiological substrate of tyrosine phosphatase SHP-2
JOURNAL J. Biol. Chem. 273 (45), 29367-29372 (1998)
PUBMED 9792637
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
DA725074.1, AF478447.1, Z99943.1 and AW292498.1.
On Apr 1, 2009 this sequence version replaced gi:46358425.
Transcript Variant: This variant (2) lacks an alternate coding exon
compared to variant 1, that causes a frameshift. The resulting
isoform (b) is shorter and has a distinct C-terminus compared to
isoform a.
Sequence Note: This RefSeq record was created from transcript and
genomic sequence data to make the sequence consistent with the
reference genome assembly. The genomic coordinates used for the
transcript record were based on transcript alignments.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AF478447.1, BM473969.1 [ECO:0000332]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-196 DA725074.1 1-196
197-1090 AF478447.1 155-1048
1091-4616 Z99943.1 64400-67925
4617-4923 AW292498.1 1-307 c
FEATURES Location/Qualifiers
source 1..4923
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="1"
/map="1q24.2"
gene 1..4923
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/note="myelin protein zero-like 1"
/db_xref="GeneID:9019"
/db_xref="HGNC:7226"
/db_xref="MIM:604376"
exon 1..293
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/inference="alignment:Splign:1.39.8"
CDS 203..832
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/note="isoform b precursor is encoded by transcript
variant 2; protein zero related; myelin protein zero-like
protein 1; immunoglobulin family transmembrane protein;
protein zero-related"
/codon_start=1
/product="myelin protein zero-like protein 1 isoform b
precursor"
/protein_id="NP_078845.3"
/db_xref="GI:46358426"
/db_xref="CCDS:CCDS44273.1"
/db_xref="GeneID:9019"
/db_xref="HGNC:7226"
/db_xref="MIM:604376"
/translation="
MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGAQSYMHS
"
sig_peptide 203..313
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/inference="COORDINATES: ab initio prediction:SignalP:4.0"
misc_feature 317..664
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/note="Immunoglobulin domain; Region: Ig; cl11960"
/db_xref="CDD:213125"
misc_feature 326..664
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/note="Immunoglobulin V-set domain; Region: V-set;
pfam07686"
/db_xref="CDD:203725"
misc_feature 689..751
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (O95297.1);
transmembrane region"
variation 242
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:113319606"
variation 243
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:368926182"
exon 294..460
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/inference="alignment:Splign:1.39.8"
variation 319
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:200435022"
variation 338
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:369822857"
variation 372
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:375713174"
variation 397
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:150711804"
variation 404
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:146968580"
variation 415
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:143448673"
variation 418
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:201705663"
variation 450
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:369996563"
exon 461..674
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/inference="alignment:Splign:1.39.8"
variation 465
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:201193049"
variation 484
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:375159380"
variation 504
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:368816230"
variation 586
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:371291585"
variation 615
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:141242973"
variation 619
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:150774030"
variation 649
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:375912956"
variation 665
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:367767112"
exon 675..807
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/inference="alignment:Splign:1.39.8"
variation 746
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="g"
/db_xref="dbSNP:375340075"
variation 747
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:368992613"
variation 779
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="c"
/db_xref="dbSNP:373029251"
variation 799
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:200583957"
exon 808..4907
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/inference="alignment:Splign:1.39.8"
variation 830
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="g"
/replace="t"
/db_xref="dbSNP:146099511"
variation 840
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:139028868"
variation 844
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:146869026"
variation 861..862
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace=""
/replace="t"
/db_xref="dbSNP:34626910"
STS 871..1027
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/standard_name="SHGC-75878"
/db_xref="UniSTS:7599"
variation 890
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:375874838"
variation 891
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:200004895"
variation 899
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:190661858"
variation 921
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:377498586"
variation 1044
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:141592237"
variation 1080
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="g"
/replace="t"
/db_xref="dbSNP:150901710"
variation 1095
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:78809449"
variation 1190
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:182898542"
variation 1191
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:185441444"
variation 1234
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:190151302"
variation 1359
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:41270734"
variation 1493
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:182824572"
STS 1520..1665
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/standard_name="RH12295"
/db_xref="UniSTS:58576"
variation 1597
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:112509046"
variation 1607
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="c"
/db_xref="dbSNP:187389510"
variation 1702
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:193160724"
variation 1708
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:138177732"
variation 1710
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:183755663"
variation 1769
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:73037892"
variation 1774
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="g"
/db_xref="dbSNP:114584283"
variation 1788
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:115952869"
variation 1811
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="t"
/db_xref="dbSNP:72697779"
variation 1819
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:149549702"
variation 1831
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="g"
/db_xref="dbSNP:370896138"
variation 1840
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:193135489"
variation 1849
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="g"
/db_xref="dbSNP:147274411"
variation 1868
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace=""
/replace="t"
/db_xref="dbSNP:34678493"
variation 1945
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:140780938"
variation 2013
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:720612"
variation 2024
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:113574305"
variation 2054
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:147412044"
variation 2072
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="c"
/db_xref="dbSNP:183563193"
variation 2087..2088
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace=""
/replace="a"
/db_xref="dbSNP:35089441"
variation 2130
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:12072200"
variation 2177
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="g"
/db_xref="dbSNP:186815046"
variation 2188
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:7414295"
variation 2258
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="c"
/db_xref="dbSNP:191636295"
variation 2271
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:184020611"
variation 2273
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="t"
/db_xref="dbSNP:189800509"
variation 2293
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:182056523"
variation 2306
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:185413057"
variation 2402
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:10125"
variation 2414
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:142735758"
variation 2441
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:114704696"
variation 2444..2448
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace=""
/replace="aagat"
/db_xref="dbSNP:66529257"
variation 2460
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:76940524"
variation 2474
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:35215126"
STS 2489..3324
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/standard_name="MPZL1__7200"
/db_xref="UniSTS:466339"
variation 2535
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:3752606"
variation 2591
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:151009335"
variation 2633
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="g"
/replace="t"
/db_xref="dbSNP:140712114"
variation 2652
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:3088322"
variation 2747
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:143124803"
variation 2749
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="g"
/db_xref="dbSNP:12745388"
variation 2884
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:74388383"
variation 2890
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="c"
/db_xref="dbSNP:146700702"
STS 2914..2988
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/standard_name="D1S1803E"
/db_xref="UniSTS:150719"
STS 3003..3140
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/standard_name="WI-12092"
/db_xref="UniSTS:34243"
STS 3004..3103
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/standard_name="D1S1795E"
/db_xref="UniSTS:47740"
variation 3027
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:190565454"
variation 3032
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:7605"
STS 3114..3869
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/standard_name="FLJ21047_2474"
/db_xref="UniSTS:463588"
STS 3164..3265
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/standard_name="RH36145"
/db_xref="UniSTS:64757"
variation 3170
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="g"
/db_xref="dbSNP:11807657"
variation 3271
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:181999887"
variation 3324
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:14212"
variation 3355..3358
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace=""
/replace="agtt"
/db_xref="dbSNP:374021239"
variation 3402
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:61995896"
variation 3489
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="g"
/db_xref="dbSNP:140274317"
variation 3502
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:8917"
variation 3589
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:8623"
variation 3603
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:185284937"
STS 3613..3726
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/standard_name="A007A43"
/db_xref="UniSTS:35948"
variation 3645
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:145325991"
variation 3653
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:12316"
variation 3916
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="g"
/replace="t"
/db_xref="dbSNP:12071420"
variation 3940
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:189891170"
variation 3947
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="g"
/db_xref="dbSNP:148979779"
variation 4060
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="g"
/db_xref="dbSNP:113581119"
variation 4149
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:148155475"
variation 4176
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:141847648"
variation 4221
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:368920044"
variation 4273
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="g"
/db_xref="dbSNP:10753763"
variation 4320
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="g"
/db_xref="dbSNP:76775177"
variation 4357
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="c"
/db_xref="dbSNP:371184482"
variation 4386
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:35065671"
variation 4442
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="t"
/db_xref="dbSNP:139012766"
variation 4472
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:181105938"
variation 4482
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:10753764"
variation 4498
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:186660095"
variation 4551
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:191445959"
variation 4557
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:183602418"
variation 4558
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:10800323"
variation 4639
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:188493549"
variation 4724
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:143146901"
variation 4821
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:192283907"
variation 4904
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:147481157"
ORIGIN
agcgagggccggagtggggctgaggcttcggtgcagagctggagagccgcggctgggaccggagtggggagcgcggcgtggaggtgccacccggcgcgggtggcggagagatcagaagcctcttccccaagccgagccaacctcagcggggacccgggctcagggacgcggcggcggcggcggcgactgcagtggctggacgatggcagcgtccgccggagccggggcggtgattgcagccccagacagccggcgctggctgtggtcggtgctggcggcggcgcttgggctcttgacagctggagtatcagccttggaagtatatacgccaaaagaaatcttcgtggcaaatggtacacaagggaagctgacctgcaagttcaagtctactagtacgactggcgggttgacctcagtctcctggagcttccagccagagggggccgacactactgtgtcgtttttccactactcccaagggcaagtgtaccttgggaattatccaccatttaaagacagaatcagctgggctggagaccttgacaagaaagatgcatcaatcaacatagaaaatatgcagtttatacacaatggcacctatatctgtgatgtcaaaaaccctcctgacatcgttgtccagcctggacacattaggctctatgtcgtagaaaaagagaatttgcctgtgtttccagtttgggtagtggtgggcatagttactgctgtggtcctaggtctcactctgctcatcagcatgattctggctgtcctctatagaaggaaaaactctaaacgggattacactggggcccagtcatatatgcacagttagaccactccggcggacatcacagtgacaagattaacaagtcagagtctgtggtgtatgcggatatccgaaagaattaagagaatacctagaacatatcctcagcaagaaacaaaaccaaactggactctcgtgcagaaaatgtagcccattaccacatgtagccttggagacccaggcaaggacaagtacacgtgtactcacagagggagagaaagatgtgtacaaaggatatgtataaatattctatttagtcatcctgatatgaggagccagtgttgcatgatgaaaagatggtatgattctacatatgtacccattgtcttgctgtttttgtactttcttttcaggtcatttacaattgggagatttcagaaacattcctttcaccatcatttagaaatggtttgccttaatggagacaatagcagatcctgtagtatttccagtagacatggccttttaatctaagggcttaagactgattagtcttagcatttactgtagttggaggatggagatgctatgatggaagcatacccagggtggcctttagcacagtatcagtaccatttatttgtctgccgcttttaaaaaatacccattggctatgccacttgaaaacaatttgagaagtttttttgaagtttttctcactaaaatatggggcaattgttagccttacatgttgtgtagacttactttaagtttgcacccttgaaatgtgtcatatcaatttctggattcataatagcaagattagcaaaggataaatgccgaaggtcacttcattctggacacagttggatcaatactgattaagtagaaaatccaagctttgcttgagaacttttgtaacgtggagagtaaaaagtatcggttttattctttgctgatgtcctttctgcttgaaataacagtcaccatacagctaaaggagaggagtttctttccttctaagtaggcagaaatggtatcattatgttgccgctctccaatctcccagagctcgctctctagagaatcaccttctttcgcttttttttttttttttgaggtagagtctcactatgttgcccagactagccttgaactcttgggctcaagtgattctccctcctcagcctcccgagtagctggaacgaactatagttgcaccactgcagctggcaagaatcaccttctttataaagcgtcagtcatgcttccagcaagaggcagcatcagtcatggctttataacagcttcatggtgcctcaaagactgttgaggttaatgagagcctagattagacagtttggctgtccttccctaaaacttgttttctcctattcactactccccaccgcacttaaaatctatgagtttttactttttactgggaatggaaagtgtggtgaagatcattcaacacttatgttgtcatttctcccattttctgaatttttttttaaatttccccccttttaaaattgttcgaaagcccacagttatggaaagaattactgtctagatggtctgcagaacgtgtttggggtgagtgggagtgaggggcaatgttactttttctccctgtagtttggagtccattatgagctgctgctttttcttctcatcttgtcatcttctggggatgtttgaaggctgagttccaacagaattcacaaagggaataaaacaggattgagattttgaggtgtgcacaaggtggtaagataaagggcatatgagcttcaaaactaatgctgttgcatacatgaagccttttgttttttgaggagctatttttgttattcttgtaacgctccaccttacatgccacatctgtgtgagtcaacagggatcaggtttggtcaccacacatgtctgaagctgggcagcgtctgctctgtgttctgtgtggaatggagaaaaaaacgcctgccctgctgccttccatgttcataggcccagcccaagagagtgacacacagtgctggccctgagacatttccacaaagtggtcaactctgccttgcatcctaaaactttttgggcatctattttgaaaactataggagcctttggaaggcctcttatgtttggaggggaagggtgttgagattgtcaccatccttcaagctgagactcctggtgagcctttgccaccatgaaaaccacatagctgaccagggctgtgcttgaggtacagaggacacacattgtagacaggcctgtgtcatgtttccttacagtcgttttttacagagaaaaggggcattgttttttcactgctttctcaacagttcctgtgaataaatgaaacatttcggagctccctgagagcaagagccttcacttcttcttgcggtgccgggaccatgtgttggtgaagctggtgctgtgggggccactcactcgaatgacacctggaggcctgttcctcccttaccactcccttccccagcccgacttcttggcctcctgcccaaccagacacctcaaactctgtcagtgccctggcattctggcagagaatcctcaccagttctcaccaaccttccccccaggcaagggcagctgccagcatggtgctctgccaggacaggtttccctgaaggaagctgctcacactgagatgagcctctcagggcaggacctcttcccaagccctgcacacccacccctgcagcccttttggctccccttttccctgtgcctcagcactcctttcctggttgcagataacgaactaaggttgcctaaagggcagatctgccctctccatgtcttcgtcctggcaaacagggtcgtcttaaaattatgcgctaattctgtatgggagcactcaaaaggcattacttagagattgaaatttcaaactatctctagtttttcaatggaaatatatcagctagggaaaaaccatcaagctcattattattttttgatcttcagttgtatttttgtgaatattttaatacatctttttcaatttctgaattgtgttgtgtgctcattttgaccagaatagaaaaagagatatgcctttcactcatatcattccagctacacctgccttcttttcttcaaaaatgccgtccgtgtgcctgcttctgggcctttgcacatgctgttccctgggcctgaagcatgccttctgccaatattcctgtggtttgctctctgacttcctttaagcctctgctcaaatgttacctcctcagggagaccttctgtgatatataaaagagcaagccccccaccccaccgcctcagccttcctggccccctcagttctgctctagttactctatttctctccctctttcccagtacacacttgtctgttctcccgcattagaacatagttaacaagagaccagaaccttgctgttttgttcactgctccgtctgcagtaaagggaacagcacctggcacttagctgctcaatacatgttacgtggatggatgagtaggtggaagcattcatccattcagcaacctacactgagaacaatcctgtgccaagcactgtgctaagcataaggaaacaaaacaagacaaagctcctcaaggagcttgccacagggtggaggtgacaggtgacatgaatggaagtaactagtagttaccaaatacttggtgtgagccaggcactttgcatttctttctctattatttctgtgagttaacagtaattgtactaatcttaatcccattgtttgaaagattatatggcttacccagggccacttagctaataaaggaacagagaagaggggctgggcctggggccgctgtttgatccacagccttgttcctaaccactatgccctgtggcctctcacaccaaaaggaagtaccaaactgcttccttactcaaataaatgtgctgaaatgcagttgcagttttctcccagtcccttaggagctggttagagagtcccttaggaacttgagagggtagtgtagtctaggtggtaggcacagatgtctgagagctttaacctcagtctggaagacaatgtggtgacttaatttgttgagaactatgttacaaataatgtgttactaataaaacattgaggcttcgcaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:9019 -> Molecular function: GO:0005198 [structural molecule activity] evidence: TAS
GeneID:9019 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:9019 -> Biological process: GO:0007169 [transmembrane receptor protein tyrosine kinase signaling pathway] evidence: TAS
GeneID:9019 -> Biological process: GO:0007267 [cell-cell signaling] evidence: TAS
GeneID:9019 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.