Home |
Help |
Advanced search
2024-04-19 14:25:01, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_024065 1086 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens phosducin-like 3 (PDCL3), mRNA.
ACCESSION NM_024065
VERSION NM_024065.4 GI:163310761
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1086)
AUTHORS Stirling,P.C., Srayko,M., Takhar,K.S., Pozniakovsky,A., Hyman,A.A.
and Leroux,M.R.
TITLE Functional interaction between phosducin-like protein 2 and
cytosolic chaperonin is essential for cytoskeletal protein function
and cell cycle progression
JOURNAL Mol. Biol. Cell 18 (6), 2336-2345 (2007)
PUBMED 17429077
REMARK GeneRIF: Data support a model in which Plp2p modulates the
biogenesis of several CCT substrates relating to cell cycle and
cytoskeletal function, which together contribute to the essential
function of PLP2.
GeneRIF: Data support a model in which Plp2p modulates the
biogenesis of several CCT substrates relating to cell cycle and
cytoskeletal function, which together contribute to the essential
function of PLP2.
REFERENCE 2 (bases 1 to 1086)
AUTHORS Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z.,
Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S.,
McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J.,
Dunham,I., Hill,D.E. and Vidal,M.
TITLE hORFeome v3.1: a resource of human open reading frames representing
over 10,000 human genes
JOURNAL Genomics 89 (3), 307-315 (2007)
PUBMED 17207965
REFERENCE 3 (bases 1 to 1086)
AUTHORS Wilkinson,J.C., Richter,B.W., Wilkinson,A.S., Burstein,E.,
Rumble,J.M., Balliu,B. and Duckett,C.S.
TITLE VIAF, a conserved inhibitor of apoptosis (IAP)-interacting factor
that modulates caspase activation
JOURNAL J. Biol. Chem. 279 (49), 51091-51099 (2004)
PUBMED 15371430
REFERENCE 4 (bases 1 to 1086)
AUTHORS Lopez,P., Yaman,R., Lopez-Fernandez,L.A., Vidal,F., Puel,D.,
Clertant,P., Cuzin,F. and Rassoulzadegan,M.
TITLE A novel germ line-specific gene of the phosducin-like protein
(PhLP) family. A meiotic function conserved from yeast to mice
JOURNAL J. Biol. Chem. 278 (3), 1751-1757 (2003)
PUBMED 12424248
REMARK GeneRIF: This publication pertains to mouse.
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
BI820064.1, BC001021.2 and AI741007.1.
On Dec 19, 2007 this sequence version replaced gi:51944951.
Summary: This gene encodes a member of the phosducin-like protein
family and is a putative modulator of heterotrimeric G proteins.
The protein shares extensive amino acid sequence homology with
phosducin. Members of the phosducin-like protein family have been
shown to bind to the beta-gamma subunits of G proteins. [provided
by RefSeq, Jul 2008].
##Evidence-Data-START##
Transcript exon combination :: BI820064.1, AF267853.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-21 BI820064.1 1-21
22-1045 BC001021.2 1-1024
1046-1086 AI741007.1 1-41 c
FEATURES Location/Qualifiers
source 1..1086
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="2"
/map="2q11.2"
gene 1..1086
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/note="phosducin-like 3"
/db_xref="GeneID:79031"
/db_xref="HGNC:28860"
/db_xref="HPRD:17827"
/db_xref="MIM:611678"
exon 1..118
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/inference="alignment:Splign:1.39.8"
variation 70
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="g"
/db_xref="dbSNP:367552527"
misc_feature 98..100
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/note="upstream in-frame stop codon"
variation 108
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="g"
/db_xref="dbSNP:372336455"
variation 109
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="c"
/replace="t"
/db_xref="dbSNP:188546477"
CDS 113..832
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/note="IAP-associated factor VIAF1; phPL3; VIAF-1; viral
IAP-associated factor 1"
/codon_start=1
/product="phosducin-like protein 3"
/protein_id="NP_076970.1"
/db_xref="GI:13129044"
/db_xref="CCDS:CCDS33261.1"
/db_xref="GeneID:79031"
/db_xref="HGNC:28860"
/db_xref="HPRD:17827"
/db_xref="MIM:611678"
/translation="
MQDPNADTEWNDILRKKGILPPKESLKELEEEAEEEQRILQQSVVKTYEDMTLEELEDHEDEFNEEDERAIEMYRRRRLAEWKATKLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCALINQHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTIFVYLEGDIKAQFIGPLVFGGMNLTRDELEWKLSESGAIMTDLEENPKKPIEDVLLSSVRRSVLMKRDSDSEGD
"
misc_feature 134..718
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/note="Phosducin (Phd)-like family, Viral inhibitor of
apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF
is a Phd-like protein that functions in caspase activation
during apoptosis. It was identified as an IAP binding
protein through a screen of a human...; Region:
Phd_like_VIAF; cd02988"
/db_xref="CDD:48537"
misc_feature order(134..136,143..154,161..163,167..172,176..178,
335..337,347..349,620..622,629..643,710..718)
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/note="putative G protein beta interface [polypeptide
binding]; other site"
/db_xref="CDD:48537"
misc_feature 812..814
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q9H2J4.1); phosphorylation site"
misc_feature 818..820
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q9H2J4.1); phosphorylation site"
exon 119..245
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/inference="alignment:Splign:1.39.8"
variation 127
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="c"
/replace="t"
/db_xref="dbSNP:17024505"
variation 173
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="c"
/replace="t"
/db_xref="dbSNP:115241531"
variation 177
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="c"
/replace="g"
/db_xref="dbSNP:148565630"
variation 178
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="c"
/replace="t"
/db_xref="dbSNP:146578292"
exon 246..336
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/inference="alignment:Splign:1.39.8"
variation 268
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="g"
/replace="t"
/db_xref="dbSNP:371895371"
variation 295
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="c"
/replace="t"
/db_xref="dbSNP:145022980"
exon 337..480
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/inference="alignment:Splign:1.39.8"
variation 337
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="t"
/db_xref="dbSNP:199816062"
variation 338
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="c"
/replace="t"
/db_xref="dbSNP:141145143"
variation 385
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="c"
/replace="t"
/db_xref="dbSNP:1052117"
variation 391
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="c"
/db_xref="dbSNP:189932200"
variation 435
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="g"
/db_xref="dbSNP:143524977"
variation 436
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="t"
/db_xref="dbSNP:143513425"
variation 461
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="g"
/db_xref="dbSNP:35116653"
variation 476
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="c"
/replace="t"
/db_xref="dbSNP:201629421"
variation 478
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="g"
/db_xref="dbSNP:374220238"
variation 480
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="g"
/db_xref="dbSNP:146120554"
exon 481..689
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/inference="alignment:Splign:1.39.8"
variation 490
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="c"
/replace="g"
/db_xref="dbSNP:143673019"
variation 515
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="c"
/db_xref="dbSNP:370314308"
STS 598..834
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/standard_name="SHGC-57056"
/db_xref="UniSTS:32959"
variation 599
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="c"
/replace="t"
/db_xref="dbSNP:200896946"
variation 606
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="c"
/replace="t"
/db_xref="dbSNP:200163857"
variation 625
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="c"
/db_xref="dbSNP:374692902"
variation 654
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="c"
/replace="t"
/db_xref="dbSNP:138096442"
variation 656
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="c"
/replace="g"
/db_xref="dbSNP:143476375"
variation 677
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="c"
/replace="t"
/db_xref="dbSNP:200109003"
variation 685
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="g"
/db_xref="dbSNP:149247434"
variation 687
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="g"
/db_xref="dbSNP:201530022"
exon 690..1075
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/inference="alignment:Splign:1.39.8"
variation 691
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="g"
/db_xref="dbSNP:376014040"
variation 695
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="g"
/db_xref="dbSNP:200281633"
variation 698
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="c"
/replace="t"
/db_xref="dbSNP:144440863"
variation 723
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="t"
/db_xref="dbSNP:367787310"
variation 728
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="g"
/db_xref="dbSNP:202185256"
variation 734
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="c"
/replace="g"
/db_xref="dbSNP:183470470"
variation 738
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="g"
/db_xref="dbSNP:142001795"
variation 757
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="g"
/db_xref="dbSNP:4618078"
variation 759
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="c"
/replace="t"
/db_xref="dbSNP:139282881"
variation 766
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="c"
/replace="t"
/db_xref="dbSNP:145184150"
variation 767
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="g"
/db_xref="dbSNP:201375611"
variation 784
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="c"
/replace="g"
/db_xref="dbSNP:200273541"
variation 788
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="c"
/replace="t"
/db_xref="dbSNP:199536229"
variation 789
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="g"
/db_xref="dbSNP:375546662"
variation 820
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="c"
/replace="t"
/db_xref="dbSNP:145284007"
variation 821
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="g"
/db_xref="dbSNP:201395644"
variation 827
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="g"
/db_xref="dbSNP:369835454"
variation 829
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="c"
/replace="g"
/db_xref="dbSNP:373289209"
variation 1008
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace=""
/replace="t"
/db_xref="dbSNP:34182904"
variation 1024
/gene="PDCL3"
/gene_synonym="HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1"
/replace="a"
/replace="g"
/db_xref="dbSNP:112508569"
ORIGIN
gaaggctgggctgggggaagaggcgtggcggcgctgtgcgcgtgcacaaaagagagctgaggggcgggggcgctgcggcacagctggtttgagcaactgaactggaaacaagatgcaggaccccaacgcagacactgaatggaatgacatcttacgcaaaaagggtatcttaccccccaaggaaagtctgaaagaattggaagaggaggcagaagaggagcagcgcatcctccagcagtcagtggtgaaaacatatgaagatatgactttggaagagctggaggatcatgaagacgagtttaatgaggaggatgaacgtgctattgaaatgtacagacggcggagactggctgagtggaaagcaactaaactgaagaataaattcggagaagttttggagatctcagggaaggattatgttcaagaagttaccaaagctggcgagggcttgtgggtcatcttgcacctttacaaacaaggaattcccctctgtgccctgataaatcagcacctcagtggacttgccaggaagtttcctgatgtcaaatttatcaaagccatttcaacaacctgcatacccaattatcctgataggaatctgcccacgatatttgtttacctggaaggagatatcaaggctcagtttattggtcctctggtgtttggcggcatgaacctgacaagagatgagttggaatggaaactgtctgaatctggagcaattatgacagacctggaggaaaaccctaagaagccgattgaagacgtgttgctgtcctcagtgcggcgctctgtcctcatgaagagggacagcgattccgagggtgactgaggctacagcttctatcacatgccgaactttcttgtgacaaattgtctggattttttaaaaaaggaaaaagcaagaatgaatccttgtggtttttagttttgtataaattatgtttcaaatctttacattttggaaataatcattgctggagattctgttaaatattttggaactctttttttttttaaattatagtatttcctctaaaaaaaattaaaaccagccatttgtatggcaaatgtcaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:79031 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:79031 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:79031 -> Biological process: GO:0019048 [modulation by virus of host morphology or physiology] evidence: IEA
GeneID:79031 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.